Conserved Protein Domain Family
PRK14126

?
PRK14126: PRK14126 
cell division protein ZapA; Provisional
Statistics
?
PSSM-Id: 172616
View PSSM: PRK14126
Aligned: 32 rows
Threshold Bit Score: 138.746
Threshold Setting Gi: 42783727
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
154686996  1 MSDGKKTKTTVNIYGQHFTIIGEESKAHMRHVAGVVDDKMREINEKNPYLDINKLAVLTAVNVVHDYMKLQEKYEILERQ 80 
157693279  1 MSDGGKTKTTVEIYGQSYTIIGQETKMHMRHVASIVDDKMREINEKNPYLDINKLAVLTAVNVVHDYLKLKEQYEKLEIQ 80 
163119583  1 MSDGQKTKTTVDIYGQQFTIVGDESKSHMRHVASIVDDKMREINEKNPYLDINKLAVLTAVNVVHDYLKLKEELERLKGQ 80 
138896260  1 MTDEPKTRVSVRIYGQDYTIVGTESPAHIRLVAAFVDDKMHEFSERNPVLDVPKLAVLTAVNIANEYLKLKEEYDRLAAK 80 
52786739   1 MSDGQKTKTTVDIYGQQFTIVGDESKSHMRHVASIVDDKMREINEKNPYLDINKLAVLTAVNVVHDYLKLKEELERLKGQ 80 
56421231   1 MTGQPKTRVSVRIYGQDYTIVGAESPAHIRLVAAFVDDKMHEFSEKNPMLDVPKLAVLTAVNIASEYLKLKEEYNRLREQ 80 
212638404  7 LAEQKKTRITVDIYGQQYSIVGTESSSHIRLVASIVDDKMREISAKNPTLDTSKLAVLTAVNIVHEYIKLKDEYERLLRK 86 
261418290  1 MTGQPKTRVSVRIYGQDYTIVGAESPAHIRLVAAFVDDKMHEFSEKNPMLDVPKLAVLTAVNIASEYLKLKEEYQRLAEK 80 
305675450  1 MSDGKKTKTTVDIYGQHFTIVGEESRAHMRYVAGIVDDKMREINEKNPYLDINKLAVLTAVNVVHDYVKLQEKYEKLERQ 80 
297529144  1 MTGQPKTRVSVRIYGQDYTIVGAESPAHIRLVAAFVDDKMHEFSEKNPMLDVPKLAVLTAVNIASEYLKLKEEYQRLAEK 80 
154686996 81 LKEKE 85 
157693279 81 LKEKE 85 
163119583 81 IKEKD 85 
138896260 81 LRREK 85 
52786739  81 IKEKD 85 
56421231  81 LKKEK 85 
212638404 87 MNKEK 91 
261418290 81 LKQEK 85 
305675450 81 LKEKD 85 
297529144 81 LKQEK 85 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap