Conserved Protein Domain Family
PRK14124

?
PRK14124: PRK14124 
tRNA pseudouridine synthase B; Provisional
Statistics
?
PSSM-Id: 172614
View PSSM: PRK14124
Aligned: 11 rows
Threshold Bit Score: 493.472
Threshold Setting Gi: 160903127
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
170287878   1 MKHGILVAYKPKGPTSHDVVDEVRKKLKTRKVGHGGTLDPFACGVLIIGVNQGTRILEFYKDLKKVYWVKMRLGLITETF 80 
160903127   1 MKSGFLVINKPKGITSHDVINILRKKFGLQKIGHAGTLDPFATGVLVVGVNKATKLLEFFQNEKKTYYVKAELGIITDTF 80 
157364233   2 IPNGILLVDKPEGITSHDVVNEVRKKLCVRKVGHAGTLDPFATGLLIIGVGNGTRVLEYLMNHEKVYRVKMRLGIITETF 81 
148269216   1 MKHGILVAYKPKGPTSHDVVDEVRKKLKTRKVGHGGTLDPFACGVLIIGVNQGTRILEFYKDLKKVYWVKMRLGLITETF 80 
150020938   1 -MMGFLNLYKPKGVTSHDVVDEVRRKLNIRRVGHAGTLDPFAEGVLVVGVGSTTRLLEYLQVERKRYYVKALLGVITETF 79 
154249712   5 IISGLLLVDKDKGPTSHDIVNKVRNIFNVKQVGHAGTLDPFATGLLLVGIGKATRLLEYLQGETKVYKVKMQLGIITDTF 84 
15643619    1 MKHGILVAYKPKGPTSHDVVDEVRKKLKTRKVGHGGTLDPFACGVLIIGVNQGTRILEFYKDLKKVYWVKMRLGLITETF 80 
217077396   1 -MVGFLNAFKPKGVTSHDVIDELRKKLKTKKIGHAGTLDPFAEGVLVIGISGATRLLEYLKNEKKRYYVKAILGLITETF 79 
222100693   1 MKHGILVAYKPKGPTSHDVVDEVRKKLKTRKVGHGGTLDPFACGVLILGVNQGTRLLEFYKNLNKVYWVKMKLGLITETF 80 
239618461   2 NLNGFLFIDKPSGITSHDVVDEIRKKFGIKKVGHSGTLDPFASGLLIVGVGKATRLLEYIKGMDKTYEVEMKLGVMTDTF 81 
281411514   1 MKHGILVAYKPKGPTSHDVVDEVRKKLKTRKVGHGGTLDPFACGVLIIGVNQGTRILEFYKDLKKVYWVRMRLGLITETF 80 
170287878  81 DITGEVVEEREC-NVTEEEIREAIFSFVGEYDQVPPAYSAKKYKGERLYKLAREGKIINLPPKRVKIFKIWDVNIEGRD- 158
160903127  81 DIEGKIQEKNIVtQQHISNLKDICFSFVGEYLQVPPAYSAKKYKGKKLYEYAREGKIINLPPKKVKIYQLSNFSQEGQE- 159
157364233  82 DITGEIVEKRPV-NVTESQIIEVLKSFTGTYKQVPPAYSARKYKGEKLYELARKGKIIRLPPREVTVYEIKDISVEGCD- 159
148269216  81 DITGEVVEEREC-NATEEEIREAIFSFVGEYDQVPPAYSAKKHKGERLYKLAREGKIINLPPKRVKIFKIWDVNVEGRD- 158
150020938  80 DITGEIVEEREC-NIPDERIIDVVKSFVGKYKQVPPAYSAKKYKGERLYKLAREGKIISLPPVDVEIYGIDKIIVKKPH- 157
154249712  85 DITGTVMEENNI-NNSEREIIEAINSFIGTYKQVPPAYSAKKYQGKKLYELAREGKIINLPPREVTIYEISDIKIELPY- 162
15643619   81 DITGEVVEEREC-NVTEEEIREAIFSFVGEYDQVPPAYSAKKYKGERLYKLAREGKIINLPPKRVKIFKIWDVNIEGRD- 158
217077396  80 DITGQVKEERVC-QKSNDEIKNAILAFKGKYKQVPPAYSAKKYNGERLYKLAREGKIISLPPVEVEIYEIENIKIVPPE- 157
222100693  81 DITGEVVEEREC-NVTEEEIKEAIFSFVGEYDQVPPAYSAKKYRGERLYKLAREGKIIRLPPKRVKIFKIWDVVIEGKT- 158
239618461  82 DFTGNLVEERESsHITEEMIRDAIESFTGEYMQVPPAYSAKKYKGERLYRLARKGKIINLPPKKVTIHDIYVKSFDPVEm 161
281411514  81 DITGEVVEEREC-NATEEEIREAIFSFVGEYDQVPPAYSAKKHKGERLYKLAREGKIINLPPKRVKIFKIWDVNVEGRD- 158
170287878 159 -VSFRVEVSPGTYIRSLCMDIGYKLGCGATAVELVRESVGPHTIEESLNVFEAAPEEIenriIPLEKCLEwLPRVVVHQE 237
160903127 160 -FSFFVEVSSGTYIRSLIMDIGYALGCGAVTKELCRVKSGKFELKDSILLEEVSLEKM----LKMDEALD-LPYVKINNG 233
157364233 160 -ISFTAKVSPGTYIRSLCMDVGYALNCGAVAVELRRLSTGSFSVDEAIDVFKIDELEIlkhlRKLSSILD-FPKVILKRE 237
148269216 159 -VSFRAEVSPGTYIRSLCMDIGYKLGCGATAVELVRESVGSYTIEESLNVFEAAPEEIenriIPLEKCLEwLPRVVVHQE 237
150020938 158 -FSFEVEVSKGTYIRSLCMDIGYKLGCGATAKELKRLSVGTFDIRDAINPFEVGREKLleslIDVQKVLP-LPKVEIYKD 235
154249712 163 -VEFTTKVSAGTYIRSLCMDIGYKLGCGATTVELRRTKVGKFDVGNAVRIDE-NIEKVkghvIPMEEILD-LPKIVILDK 239
15643619  159 -VSFRVEVSPGTYIRSLCMDIGYKLGCGATAVELVRESVGPHTIEESLNVFEAAPEEIenriIPLEKCLEwLPRVVVHQE 237
217077396 158 -FSFEVVVSPGTYIRSLCMDIGYKLGCGATAVELVRKSVGKFSIKDSINPFELSSEQIvnriLRVEEVLD-LPQVEIYKD 235
222100693 159 -VSFRVEVSPGTYVRSLCMDIGYRLGCGATAVELVRESVGPHTLEESLNVFEASPEEIenrvIPMERCLEwLPRVVIFQD 237
239618461 162 aVSFVVKVSAGTYVRSLVMDIGYKLGCGATTTFLRRLAIGKFSVSDAVKLDEVDIKDI----KPMNEIVSfLPAIVVSRE 237
281411514 159 -VSFRAEVSPGTYIRSLCMDIGYKLGCGATAVELVRESVGSYTIEESLNVFEAAPEEIenriIPLEKCLEwLPRVVVHQE 237
170287878 238 stKMILNGSQIYLEMLKEW-DSFKKGEVVRVFNEEGRLLALAEAERNSSFLET-LRKHERNERVLTLRKVFNTR 309
160903127 234 --QLVIKGQQIYKDNVLEF-SNFNKNDYVKIYDEKECFLGIGRAEKKSTFLRTlLKEEERNDRIVKIYKILYEV 304
157364233 238 alGKAFNGAKIKVSDIEKF-EEFEKNSLVQVIF-SNELICIARTERKSSFIRT-LMKKEADENLLKPLKVFRGN 308
148269216 238 stKTILNGSQIHLEMLKEW-DGFKKGEVVRVFNEEGRLLALAEAERNSSFLET-LRKHERNERVLTLRKVFNTR 309
150020938 236 fvENIYNGNQPTLDFVKEMvDSFSKDDDVMLIC-NGQLVAIAKAERNSKF----LEKNLPRGRIFKLKKVFKEI 304
154249712 240 --TKVYNGIHPKVEDLISY-DNFKKDDLVQIFA-DGKLIAIAMAERNSSFIET-LKKQSRNERILTLEKVFRLD 308
15643619  238 stKMILNGSQIHLEMLKEW-DGFKKGEVVRVFNEEGRLLALAEAERNSSFLET-LRKHERNERVLTLRKVFNTR 309
217077396 236 yvEKIFNGVQPTMDFVKEIkDDFRKDQDVMLVC-NGRLVAIAVSQRTSNF----LKKNEVRGTVFKLKKVFREG 304
222100693 238 fsERILNGSQVFLEMLKEW-DEFRKEDTVRVFDEEGNLLALAEAERNASFLRT-LKRQGRNERVLKLKKVFNMR 309
239618461 238 qaEKVLNGGQVYSNGVVEIkGVFPKEAVIRIIDEDQNLLAIARSERTSKFIKT-LTKKVSKERVATLEKVFRG- 309
281411514 238 stKTILNGSQIHLEMLKEW-DGFKKGEVVRVFNEEGQLLALAEAERNSSFLET-LRKHERNERVLTLRKVFNTR 309
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap