Conserved Protein Domain Family
gpmA

?
PRK14118: gpmA 
2,3-diphosphoglycerate-dependent phosphoglycerate mutase
Statistics
?
PSSM-Id: 172608
View PSSM: PRK14118
Aligned: 23 rows
Threshold Bit Score: 478.313
Threshold Setting Gi: 152978253
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
218768576   1 MELVFIRHGQSEWNAKNLFTGWRDVKLSEQGLAEAAAAGKKLKENGYEFDIAFTSVLTRAIKTCNIVLEESDQLFVPQIK 80 
121635257   1 MELVFIRHGQSEWNAKNLFTGWRDVKLSEQGLAEAAAAGKKLKENGYEFDIAFTSVLTRAIKTCNIVLEESDQLFVPQIK 80 
152978253   1 MQLVFIRHGLSEWNALNLFTGWRDVNLSEKGVEEAKEAGRKLKAAGFEFDIAFTSVLTRAIKTCNLVLEESDQLWVPQIK 80 
194097828   1 MELVFIRHGQSEWNAKNLFTGWRDVKLSEQGLAEAAAAGKKLKENGYEFDIAFTSVLTRAIKTCNIVLEESDQLFVPQIK 80 
161870454   1 MELVFIRHGQSEWNAKNLFTGWRDVKLSEQGLAEAAAAGKKLKENGYEFDIAFTSVLTRAIKTCNIVLEESDQLFVPQIK 80 
59801617    1 MELVFIRHGQSEWNAKNLFTGWRDVKLSEQGLAEAAAAGKKLKENGYEFDIAFTSVLTRAIKTCNIVLEESDQLFVPQIK 80 
15677454    1 MELVFIRHGQSEWNAKNLFTGWRDVKLSEQGLAEAAAAGKKLKENGYEFDIAFTSVLTRAIKTCNIVLEESDQLFVPQIK 80 
33152689    1 MELVFIRHGFSEWNAKNLFTGWRDVNLTERGVEEAKAAGQKLLAAGYEFDIAFTSVLTRAIKTCNIVLEESNQLWIPQVK 80 
251793776   1 MELVFIRHGFSEWNAKNLFTGWRDVNLTERGVEEAKAAGKKLLDAGFEFDIAFTSVLTRAIKTCNIVLEESHQLWIPQVK 80 
254805368   1 MELVFIRHGQSEWNAKNLFTGWRDVKLSGQGLAEAAAAGKKLKENGYEFDIAFTSVLTRAIKTCNIVLEESDQLFVPQIK 80 
218768576  81 TWRLNERHYGRLQGLDKKQTAEQYGDEQVRIWRRSYDTLPPLLDKDDEFSAHKDRRYAHLPADVIPDGENLQVTLERVLP 160
121635257  81 TWRLNERHYGQLQGLDKKQTAEQYGDEQVRIWRRSYDTLPPLLDKDDEFSAHKDRRYAHLPADVVPDGENLKVTLERVLP 160
152978253  81 TWRLNERHYGGLQGLNKAEAAAEHGDEQVRIWRRSYDVLPPVLDPKDPNSAHNDRRYAHLPADVVPDCENLKVTLDRVLP 160
194097828  81 TWRLNERHYGRLQGLDKKQTAEKYGDEQVRIWRRSYDTLPPLLDKDDAFSAHKDRRYAHLPADVVPDGENLKVTLERVLP 160
161870454  81 TWRLNERHYGQLQGLDKKQTAEKYGDEQVRIWRRSYDTLPPLLDKDDEFSAHKDRRYAHLPADVVPDGENLKVTLERVLP 160
59801617   81 TWRLNERHYGRLQGLDKKQTAEKYGDEQVRIWRRSYDTLPPLLDKDDAFSAHKDRRYAHLPADVVPDGENLKVTLERVLP 160
15677454   81 TWRLNERHYGQLQGLDKKQTAEQYGDEQVRIWRRSYDTLPPLLDKDDEFSAHKDRRYAHLPADVVPDGENLKVTLERVLP 160
33152689   81 HWRLNERHYGELQGLDKKATAEKYGDEQVHIWRRSYDTLPPLLAPSDPNSAHNDRRYAHLPKEVVPNGENLKVTLERVLP 160
251793776  81 NWRLNERHYGELQGLDKKATAEKYGDEQVHIWRRSYDTLPPLLDPKDPNSAHNDRRYAHLPDDVIPDGENLKVTLERVLP 160
254805368  81 TWRLNERHYGQLQGLDKKQTAEKYGDEQVRIWRRSYDTLPPLLDKDDEFSAHKDRRYAHLPADVVPDGENLKVTLERVLP 160
218768576 161 FWEDQIAPAILSGKRVLVAAHGNSLRALAKHIEGISDEDIMGLEIPTGQPLVYKLDDNLKVIEKFYL 227
121635257 161 FWEDQIAPAILSGKRVLVAAHGNSLRALAKHIEGISDKDIMGLEIPTGQPLVYKLDDNLKVLEKFYL 227
152978253 161 FWEDQIAPAIKAGKRVLVAAHGNSLRALAKHIEGISDEDIMGLEIPTGQPLVYELDDNLKVLSKRYL 227
194097828 161 FWEDQIAPAILSGKRVLVAAHGNSLRALAKHIEGISDEDIMGLEIPTGQPLVYKLDDNLKVIEKFYL 227
161870454 161 FWEDQIAPAILSGKRVLVAAHGNSLRALAKHIEGISDEDIMGLEIPTGQPLVYKLDDNLKVLEKFYL 227
59801617  161 FWEDQIAPAILSGKRVLVAAHGNSLRALAKHIEGISDEDIMGLEIPTGQPLVYKLDDNLKVIEKFYL 227
15677454  161 FWEDQIAPAILSGKRVLVAAHGNSLRALAKHIEGISDEDIMGLEIPTGQPLVYKLDDNLKVIEKFYL 227
33152689  161 FWEDQIAPALLSGKRVLVTAHGNSLRALAKHIIGISDAEIMDFEIPTGQPLVLKLDSKLNFIEKFYL 227
251793776 161 FWDDQIAPALLSGKRVLVVAHGNSLRALAKHIEGISDADIMDLEIPTGQPLVYKLDDNLKVVEKFYL 227
254805368 161 FWEDQIAPAILSGKRVLVAAHGNSLRALAKHIEGISDEDIMGLEIPTGQPLVYKLDDNLKVIEKFYL 227
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap