Conserved Protein Domain Family
gpmA

?
PRK14116: gpmA 
2,3-diphosphoglycerate-dependent phosphoglycerate mutase
Statistics
?
PSSM-Id: 172606
View PSSM: PRK14116
Aligned: 22 rows
Threshold Bit Score: 467.083
Threshold Setting Gi: 58336527
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
148543385   1 MAKLVLIRHGQSEWNLSNQFTGWVDVDLSEKGVEQAKNAGKALKEHGIEFDYAYTSVLKRAIKTLHYALEECDQLWIPEY 80 
184152795   1 MAKLVLIRHGQSEWNLSNQFTGWVDVDLSEKGVEQAKNAGKALKEHGIEFDYAYTSVLKRAIKTLHYALEECDQLWIPEY 80 
184154611   1 MAKLVLIRHGQSEWNLSNLFTGWVDVDLSEKGVEQAKAAGKAIKEHGLEFDYAYTSVLKRAIKTLHYALEESDQMWIPEF 80 
116493438   1 MAKLVLIRHGQSQWNLSNQFTGWVDVDLSDEGVKQAQNAGKLIKEAGIEFDQAYTSVLTRAIKTLHYALEGSDQLWIPET 80 
116513411   1 MSKLVLIRHGQSEWNLSNQFTGWVDVNLSDKGVEEAKKAGRLIKEAGLEFDQAYTSVLTRAIKTLHFALEESGQLWVPET 80 
116334603   1 MAKLVLIRHGQSEWNLENKFTGWVDVDLSEKGVEEAKAAGNKIKESGLKFDYAYTSVLKRAIKTLHYVLEESDQLWIPET 80 
81427816    1 MAKLVFIRHGQSEWNLSNQFTGWVDVNLSEEGVRQAQNAGALLKKEGILFDQAYTSVLTRAIKTLHYALEGSDQLWIPET 80 
104773424   1 MSKLVLIRHGQSEWNLSNQFTGWVDVNLSDKGVEEAKKAGRLIKEAGLEFDQAYTSVLTRAIKTLHFALEESGQLWVPET 80 
28379560    1 MAKLVLIRHGQSEWNLSNQFTGWVDVDLSEKGVEEAKAAGQKVKEAGLEFDYAFTSVLTRAIKTLHYVLEESDQLWIPET 80 
254557701   1 MAKLVLIRHGQSEWNLSNQFTGWVDVDLSEKGVEEAKAAGQKVKEAGLEFDYAFTSVLTRAIKTLHYVLEESDQLWIPET 80 
148543385  81 KTWRLNERHYGALQGHNKQKAAEKYGDEQVHIWRRSYDVLPPLLSADDEGSAAKDRRYANLDPRAIPGGENLKVTLERVI 160
184152795  81 KTWRLNERHYGALQGHNKQKAAEKYGDEQVHIWRRSYDVLPPLLSADDEGSAAKDRRYANLDPRAIPGGENLKVTLERVI 160
184154611  81 KTWRLNERHYGALQGKNKADAAEKYGDEQVHIWRRSYDVLPPLLSADDEGSAAKDRRYADLDPRAIPGGENLKVTLERVI 160
116493438  81 KTWRLNERHYGALQGQNKAEAAEKWGDDQVHTWRRSYDVLPPLLDADDEGSAANDRRYANLDPRIIPGGENLKVTLERVI 160
116513411  81 KSWRLNERHYGALQGLNKAETAEKYGDEQVHIWRRSYDVLPPVLADDSEFSQANDRRYANLDPHIVPKAENLKVTLDRVM 160
116334603  81 KTWRLNERHYGALQGLNKAETAEKYGDDQVHIWRRSYDVLPPLLDADAEGSAVKDPRYANLDPNIVPGGENLKVTLERVM 160
81427816   81 KSWRLNERHYGALQGQNKAEAAEKWGDEQVHIWRRSYDTLPPLLDASDEGSAANDRRYAHLDPKAIPGGENLKVTLERVI 160
104773424  81 KSWRLNERHYGALQGLNKAETAEKYGDEQVHIWRRSYDVLPPVLADDSEFSQANDRRYANLDPHIVPKAENLKVTLDRVM 160
28379560   81 KTWRLNERHYGALQGLNKKETAEKYGDDQVHIWRRSYDVLPPLLSADDEGSAVNDRRYADLDPNIVPGGENLKVTLERVM 160
254557701  81 KTWRLNERHYGALQGLNKKETAEKYGDDQVHIWRRSYDVLPPLLSADDEGSAVNDRRYADLDPNIVPGGENLKVTLERVM 160
148543385 161 PLWQDEIAPKLLDNKNVIIAAHGNSLRALSKYIENISDEDIMNLEMATGQPVVYDFDDKLNVLSKEKY 228
184152795 161 PLWQDEIAPKLLDNKNVIIAAHGNSLRALSKYIENISDEDIMNLEMATGQPVVYDFDDKLNVLSKEKY 228
184154611 161 PLWQDEIAPKLLDGKNVIIAAHGNSLRALSKYIENISDEDIMGLEMATGQPVVYDFDEKLNVLSKEKY 228
116493438 161 PFWEDEIAPKLIDGKNVIIAAHGNSLRALSKYIENISDEDIINLEMATGEPVVYDFNEKLEVQSKTKL 228
116513411 161 PFWEDHIAPDLLAGKNVIIAAHGNSLRALTKYIENISDEDIMDVEMKTGEPVVYTFDDKLNVVSKEKL 228
116334603 161 PFWEDEIAPKLLDGKNVIIAAHGNSLRALSKYIERISDDDIMDLEMATGEPVVYDFDDKLNMTNKTKM 228
81427816  161 PFWEDEIAPKLIDGQNIIVAAHGNSLRALTKYIENISDEDIMDVEMATGEPVVYDLDENLNVVSKKKL 228
104773424 161 PFWEDHIAPDLLAGKNVIIAAHGNSLRALTKYIENISDEDIMDVEMKTGEPVVYTFDDKLNVVSKEKL 228
28379560  161 PFWEDQIAPKLLDGKNVIIAAHGNSLRALSKYIEQISDDDIMDLEMATGEPVVYDFDEKLKVLGKEKL 228
254557701 161 PFWEDQIAPKLLDGKNVIIAAHGNSLRALSKYIEQISDDDIMDLEMATGEPVVYDFDEKLKVLGKEKL 228
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap