Conserved Protein Domain Family
PRK14114

?
PRK14114: PRK14114 
1-(5-phosphoribosyl)-5- ((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase
Statistics
?
PSSM-Id: 172604
View PSSM: PRK14114
Aligned: 5 rows
Threshold Bit Score: 464.486
Threshold Setting Gi: 222100503
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
148270834   1 MLVVPAIDLFRGKVARMVKGKKENTIFYEKDPAELVKKLIEEGFTLIHVVDLSKAIENSVENFPVLERLSEFAEHIQIGG 80 
170289547   1 MLVVPAIDLFRGKVARMIKGRKENTIFYEKDPVELVEKLIEEGFTLIHVVDLSNAIENSGENLPVLEKLSEFAEHIQIGG 80 
15643795    1 MLVVPAIDLFRGKVARMIKGRKENTIFYEKDPVELVEKLIEEGFTLIHVVDLSNAIENSGENLPVLEKLSEFAEHIQIGG 80 
222100503   1 MLVIPAIDLYRKKVVRMVKGKKENTIFYEKDPIELVEKLVEEGFSLIHVVDLSRAIEESDENLPVLEKLSSYADHIQIGG 80 
281413129   1 MLVVPAIDLFRGKVARMVKGKKENTIFYEKDPAELVKKLIEEGFTLIHVVDLSKAIENSVENFPVLERLSEFAEHIQIGG 80 
148270834  81 GIRSFDYAERLRKLGYKRQIVSSKVLEDPSFLKFLKEIDVEPVFSLDTRGGKVAFKGWLAEEEIDPISLLKRLKEYGLEE 160
170289547  81 GIRSLDYAEKLRKLGYRRQIVSSKVLEDPSFLKSLREIDVEPVFSLDTRGGRVAFKGWLAEEEIDPVSLLKRLKEYGLEE 160
15643795   81 GIRSLDYAEKLRKLGYRRQIVSSKVLEDPSFLKSLREIDVEPVFSLDTRGGRVAFKGWLAEEEIDPVSLLKRLKEYGLEE 160
222100503  81 GIRILEYAKKLLGMGFRRQIVSSKVLEDPSFLKKLKEIGVNPVFSLDTREGKVAFKGWLDEKDIDPVFLVNRLKEFGLEE 160
281413129  81 GIRSFDYAERLRKLGYRRQIVSSKVLEDPSFLKFLKEIDVEPVFSLDTRGGKVAFKGWLAEEEIDPISLLKRLKEYGLEE 160
148270834 161 IVHTEIEKDGTLQEHDFSLTRKIAIEAEVNVFAAGGISSENSLKTAQRVHRETNGLLKGVIVGRAFLEGILTVEVMKRYA 240
170289547 161 IVHTEIEKDGTLQEHDFSLTKKIAIEAEVKVLAAGGISSENSLKTAQKVHTETNGLLKGVIVGRAFLEGILTVEVMKRYA 240
15643795  161 IVHTEIEKDGTLQEHDFSLTKKIAIEAEVKVLAAGGISSENSLKTAQKVHTETNGLLKGVIVGRAFLEGILTVEVMKRYA 240
222100503 161 IVHTEIEKDGTLKEHDFSLTERIALETGVKVIAAGGISSERSLEEALEVHRRTNGLLKGVIVGRAFLEGTLTVEVMKRYA 240
281413129 161 IVHTEIEKDGTLQEHDFSLTRKIAIEAEVNVFAAGGISSENSLKTAQRVHRETNGLLKGVIVGRAFLEGILTVEVMKRYA 240
148270834 241 R 241
170289547 241 R 241
15643795  241 R 241
222100503 241 C 241
281413129 241 R 241
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap