Conserved Protein Domain Family
PRK14112

?
PRK14112: PRK14112 
urease accessory protein UreE; Provisional
Statistics
?
PSSM-Id: 172602
View PSSM: PRK14112
Aligned: 3 rows
Threshold Bit Score: 243.025
Threshold Setting Gi: 170762103
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
209554123   1 MTVFKEILGNITDIENVESYQIENIHLTSDDVLKRVIIISSDQNVEYGIRLEEDKKLRDGDILYKDDYKLVVIRLELSDV 80 
170762103   1 MTVFKEILDNIANIKNVESYQIENIHLTSDDVLKRVIIISSDQNVEYGIRLEEDKKLMDGDILYKDDYKLVVIRLELSDV 80 
13357994    1 MTVFKEILDNIANIKNVESYQIENIHLTSDDVLKRVIIISSDQNVEYGIRLEEDKKLMDGDILYKDDYKLVVIRLELSDV 80 
209554123  81 LIITARTIGEMAQIAHNLGNRHMPAQFTETQMIVPYDYLVEQYLQDNKALYEREKIKLKEAFRHCSDAK 149
170762103  81 LIITAHTIGEMAKIAHNLGNRHMPAQFTETQMIVPYDYLVEEYLQDNKALYERKKIKLKEAFKHCSDAK 149
13357994   81 LIITAHTIGEMAKIAHNLGNRHMPAQFTETQMIVPYDYLVEEYLQDNKALYERKKIKLKEAFKHCSDAK 149
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap