Conserved Protein Domain Family
PRK14104

?
PRK14104: PRK14104 
chaperonin GroEL; Provisional
Statistics
?
PSSM-Id: 172594
View PSSM: PRK14104
Aligned: 15 rows
Threshold Bit Score: 901.705
Threshold Setting Gi: 86750345
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
90424663    1 MSAKEVKFGVDARDRMLRGVDILANAVKVTLGPKGRNVVLDKSFGAPRITKDGVTVAKEIELEDKFENMGAQMVREVASK 80 
192290841   1 MSAKEVKFGVDARDRMLRGVDILANAVKVTLGPKGRNVVLDKSFGAPRITKDGVTVAKDIELDDKFENMGAQMVREVASK 80 
92116746    1 MSAKEVKFGVDARDRMLRGVEILNNAVKVTLGPKGRNVVLDKSYGAPRITKDGVTVAKEIELEDKFENMGAQMVREVASK 80 
91976704    1 MSAKEVKFGVDARDRMMRGVDILANAVKVTLGPKGRNVVLDKSFGAPRITKDGVTVAKEIELDDKFENMGAQMVREVASK 80 
92118107    1 MSAKDVKFGVDARDKMLRGVDILANAVKVTLGPKGRNVVLEKSFGAPRITKDGVTVAKEIELEDKFENMGAQMVREVASK 80 
86750345    1 MSAKEVKFGVDARDRMLRGVDILANAVKVTLGPKGRNVVLDKSFGAPRITKDGVTVAKEIELEDKFENMGAQMVREVASK 80 
115524294   1 MSAKEVKFGVDARDRMLRGVDILANAVKVTLGPKGRNVVLDKSFGAPRITKDGVTVAKDIELEDKFENMGAQMVREVASK 80 
27377170    1 MSAKEVKFGVNARDRMLRGVDILANAVQVTLGPKGRNVVLDKSFGAPRITKDGVAVAKEIELDDKFENMGAQMVREVASK 80 
27382090    1 MSAKEVKFGVDARDRMLRGVDILHNAVKVTLGPKGRNVVLDKSFGAPRITKDGVTVAKEIELEDKFENMGAQMVREVASK 80 
39935233    1 MSAKEVKFGVDARDRMLRGVDILANAVKVTLGPKGRNVVLDKSFGAPRITKDGVTVAKDIELDDKFENMGAQMVREVASK 80 
90424663   81 SADLAGDGTTTATVLAAAIVREGAKSVAAGMNPMDLKRGIDLAVEAVVADLVKNSKKVTSNEEIAQVGTISANGDAEIGK 160
192290841  81 SADAAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGIDLAVEAVVADLVKNSKKVTSNDEIAQVGTISANGDAEIGK 160
92116746   81 SADAAGDGTTTATVLAAAIVKEGAKSVAAGMNPMDLKRGIDLAVEAVVADLVRNSKKVTSNEEIAQVGTISSNGDTEIGK 160
91976704   81 SADAAGDGTTTATVLAQAIVREGGKAVAAGMNPMDLKRGIDLAVEAVVADLVKNSKKVTSNEEIAQVGTISANGDVEIGK 160
92118107   81 SADAAGDGTTTATVLAQAIVREGAKSVAAGMNPMDLKRGIDLAVEAVVADLVRNSKKVTSNDEIAQVGTISANGDSEIGK 160
86750345   81 SADLAGDGTTTATVLAAAIVREGAKSVAAGMNPMDLKRGIDLAVEAVVADLVKNSKKVTSNDEIAQVGTISANGDAEIGK 160
115524294  81 SADAAGDGTTTATVLAAAIVREGAKAVAAGMNPMDLKRGIDLAVEAVVADLVKNSKKVTSNEEIAQVGTISANGDAEIGK 160
27377170   81 AADAAGDGTTTATVLAAAIVREGAKSVAAGMNPMDLKRGIDLAVEAVVADLQKNSKKVTSNDEIAQVGAISANGDQEIGK 160
27382090   81 SADAAGDGTTTATVLAAAIVREGAKSVAAGMNPMDLKRGIDMAVEAVVADLVKNSKKVTSNEEIAQVGTISANGDAEIGK 160
39935233   81 SADAAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGIDLAVEAVVADLVKNSKKVTSNDEIAQVGTISANGDAEIGK 160
90424663  161 FLSDAMKKVGNEGVITVEEAKSLETELDVVEGMQFDRGYISPYFVTNADKMRVEFDDAYILINEKKLSNLNELLPLLEAV 240
192290841 161 FLADAMKKVGNEGVITVEEAKSLETELDVVEGMQFDRGYISPYFVTNADKMRVEFDDAYILINEKKLSNLNELLPLLEAV 240
92116746  161 FLADAMKKVGNEGVITVEEAKSLETELEIVEGMQFDRGYISPYFVTNADKMRVEMEDAYVLINEKKLSQLNELLPLLEAV 240
91976704  161 FLSDAMKKVGNEGVITVEEAKSLETELDVVEGMQFDRGYISPYFVTNADKMRVEFDDAYILINEKKLSNLNELLPLLEAV 240
92118107  161 FLANAMKRVGNEGVITVEEAKSLETELDVVEGMQFDRGYISPYFVTNADKMRVEMDDAYILINEKKLSSLNELLPLLEAV 240
86750345  161 FLADAMKKVGNEGVITVEEAKSLETELDVVEGMQFDRGYISPYFVTNADKMRVEFDDAYILINEKKLSNLNELLPLLEAV 240
115524294 161 FLSDAMKKVGNEGVITVEEAKSLETELDVVEGMQFDRGYISPYFVTNADKMRVEFDDAYILINEKKLSNLNELLPLLEAV 240
27377170  161 FLADAVKKVGNEGVITVEEAKSLETELDVVEGMQFDRGYISPYFVTNADKMRVEMDDAYILINEKKLSSLNELLPLLEAV 240
27382090  161 FISDAMKKVGNEGVITVEEAKSLETELEVVEGMQFDRGYISPYFVTNADKMRVEMDDAYVLINEKKLSQLNELLPLLEAV 240
39935233  161 FLADAMKKVGNEGVITVEEAKSLETELDVVEGMQFDRGYISPYFVTNADKMRVEFDDAYILINEKKLSNLNELLPLLEAV 240
90424663  241 VQTGKPLVIVAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMLQDIAILTGGQAISEDLGIKMENVTLAMLGKA 320
192290841 241 VQTGKPLVIVAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMLQDIAILTGGQAISEDLGIKMENVTLQMLGRA 320
92116746  241 VQSGKPLVIIAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMLQDIAILTGGQAISEDLGIKLENVTLAMLGRA 320
91976704  241 VQTGKPLVIVAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMLQDIAILTGGQAISEDLGIKMENVTLQMLGKA 320
92118107  241 VQTGKPLVIVAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMLQDIAILTGGQAISEDLGIKLENVTLAMLGKA 320
86750345  241 VQTGKPLVIVAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMLQDIAILTGGQAISEDLGIKMENVTLQMLGRA 320
115524294 241 VQTGKPLVIVAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMLQDIAILTGGQAISEDLGIKMENVTLAMLGKA 320
27377170  241 VQTGKPLVIVAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMLQDIAILTGGQAISEDLGIKLENVTLNMLGRA 320
27382090  241 VQSGKPLVIIAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMLQDIAILTGGQAISEDLGIKLENVTLNMLGRA 320
39935233  241 VQTGKPLVIVAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMLQDIAILTGGQAISEDLGIKMENVTLQMLGRA 320
90424663  321 KKVMIDKENTTIVNGAGKKADIEARVAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEIEVKERKDRVDDAM 400
192290841 321 KKVMIDKENTTIVNGAGKKADIEARVAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDAM 400
92116746  321 KKVMIDKENTTIVSGAGKKADIEARVNQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDAM 400
91976704  321 KKVMIDKENTTIVNGAGKKADIEARVAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEIEVKERKDRVDDAM 400
92118107  321 KKVMIDKENTTIVNGAGKKADIEARVAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDAM 400
86750345  321 KKVMIDKENTTIVNGAGKKVDIEARVAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEIEVKERKDRVDDAM 400
115524294 321 KKVMIDKENTTIVNGAGKKADIEARVAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDAM 400
27377170  321 KKVMIDKENTTIVNGAGKKADIEARVAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDAM 400
27382090  321 KKVMIDKENTTIVSGAGKKADIEARVAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDAM 400
39935233  321 KKVMIDKENTTIVNGAGKKADIEARVAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDAM 400
90424663  401 HATRAAVEEGILPGGGVALLRASEQLKRIKTQNDDQKTGVEIVRKALSWPARQIAINAGEDGSVIVGKILEKDQYSYGFD 480
192290841 401 HATRAAVEEGIVPGGGVALLRASEQLKGLKTKNDDQKTGVEIVRRALSAPARQIAINAGEDGSVIVGKVLEKEQYAFGFD 480
92116746  401 HATRAAVEEGIVPGGGVALLRASEQLKRIKTANDDQKTGVEIVRKALSAPARQIAINAGEDGSIIVGKILEKEQYSYGFD 480
91976704  401 HATRAAVEEGIVPGGGVALLRASEQLKRIKTQNDDQKTGVEIVRKALSAPARQIAINAGEDGSVIVGKVLEKDQYNYGFD 480
92118107  401 HATRAAVEEGIVPGGGVALLRASEQLKRIKTANDDQKTGVEIVRKALSAPARQIAINAGEDGSVIVGKILEKEQYSYGFD 480
86750345  401 HATRAAVEEGIVPGGGVALLRASEQLKRIKTANDDQKTGVEIVRKALSAPARQIAINAGEDGSVIVGKVLEKDQYNYGFD 480
115524294 401 HATRAAVEEGIVPGGGVALLRASEQLKGLKTKNDDQKTGVEIVRKALSWPARQIAINAGEDGSVIVGKILEKDQYNYGFD 480
27377170  401 HATRAAVEEGIVPGGGVALLRASEQLKGLRTENDDQKTGVEIVRKALSWPARQIAINAGEDGSIVVGKVLDNEQYSFGFD 480
27382090  401 HATRAAVEEGILPGGGVALLRASEHLKGIRTKNDDQKTGVEIVRKALSYPARQIAINAGEDGSVIVGKILEKDQYSYGYD 480
39935233  401 HATRAAVEEGIVPGGGVALLRASEQLKGLKTKNDDQKTGVEIVRRALSAPARQIAINAGEDGSVIVGKVLEKEQYAFGFD 480
90424663  481 SQSGEYGDMVKKGIIDPTKVVRAAIQNAASVAALLITTEAMIAELPKKGNAGGGmPPGG----GGMGGMDF 547
192290841 481 SQSGEYGDLVKKGIIDPTKVVRTAIQNAASVAALLITTEAMIAELPKKNAGPA--MPPG----GGMGGMDF 545
92116746  481 SQTGEYVNLISKGIIDPTKVVRAAIQNAASVAALLITTEAMVAELPKKNAAAPA-MP-G----GGMGGMDF 545
91976704  481 SQTGEYGDLVKKGIIDPTKVVRTAIQNAASVAALLITTEAMVAELPKKGGAAGGmPPGG----GGMGGMDF 547
92118107  481 SQSGEYGNLISKGIIDPTKVVRAAIQNAASVAALLITTEAMVAELPKKNAGGPA-MPAG----GGMGGMDF 546
86750345  481 SQTGEYGDMVKKGIIDPTKVVRAAIQNAASVAALLITTEAMIAELPKKGGAGAGgMPPG----GGMGGMDF 547
115524294 481 SQSGEYGNLVSKGIIDPTKVVRTAIQNAASVAALLITTEAMIAELPKKGNSGGG-MPPG----GGMGGMDF 546
27377170  481 AQTGEYSNLVSKGIIDPAKVVRIAVQNASSVAGLLITTEAMVAELPKKATAGPA-MPAA----PGMGGMDF 546
27382090  481 SQTGEYGNLVSKGIIDPTKVVRVAIQNAASVAALLITTEAMVAEVPKKNTGAGG-MPPGgggmGGMGGMDF 550
39935233  481 SQSGEYGDLVKKGIIDPTKVVRTAIQNAASVAALLITTEAMIAELPKKGGAGAGgMPPG----GGMGGMDF 547
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap