Conserved Protein Domain Family
PRK14098

?
PRK14098: PRK14098 
starch synthase
Statistics
?
PSSM-Id: 172588
View PSSM: PRK14098
Aligned: 10 rows
Threshold Bit Score: 937.618
Threshold Setting Gi: 194334817
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
189501162   1 MSRSTCKVLYVSGEISPFVRVSCLADFMASFPQAMEDEGCEARIMMPKYGVINDRKFRLHDVLRLSDIEVPLKDKTDLLH 80 
78186108    1 MSRRNYKVLYVSGEVSPFVRTSALADFMASFPQALEEEGFEARIMMPKYGTINDRKFRLHDVLRLSDIEVPLREKTDMLN 80 
78189764    1 MSRRNSKVLYVSGEVAPFVRITALADFMASFPQTVEDEGFEARIMMPKYGIINDRKFRLHDVLRLSDIEVHLKDKVDMLD 80 
21674823    1 MARRNFKVLYVSGESSPFVRVSSLADYMASFPQALEEEGFEARIMMPKYGIINDRKFRLHDVLRLSDIEVPLKDKTDMLH 80 
119358145   1 MARRNFKVLYVSGEVSPFVRFSALADFMASFPQAVEEEGFEARIMMPKYGTINDRKFRLHDVLRLSDIEVHLKEKTDLLH 80 
145219101   1 MSRRNFKVLYISGEVSPFVRTSALADFMASFPQALEEEGFEARIMMPKYGAINDRKFRLHDVLRLSDIEVPLKEKTDLLN 80 
193211901   1 MARRNYKVLYVSGEVSPFVRVSSLADFMASFPQALEEEGFEARIMMPKYGIINDRKFRLHDVLRLSDIEVPLKEKTEMLH 80 
189347663   1 MARRNFKVLYVSGEVSPFVRISALADFMASFPQALEEEGFEARIMMPKYGTINDRKFRLHDVLRLSDIEVNLRDKTELLH 80 
194334817   1 MSRSTCKVLYVSGEISPFIRVSALADFMASFPHAMEEEGCEARIMMPKYGVINDRKFRLHDVLRLSDIEVRSKEKTDLLH 80 
194335486   1 MSRRNFKVLYVSGEVSPFVRISPLADFMASFPQAIEEEGFEARIMMPKYGTINDRKFRLHDVLRLSDIEVDLKEKVDLLN 80 
189501162  81 VKVTALPSSKIQTYFLYNEKHNKRSGLFIDMSHGDEYKGSAERAIFFNLGILETLQRLGWKPDIIHFHDWYAGLVPLLLK 160
78186108   81 VKVTALPSSKIQTYFLYNEKYFKRNGLFTDVYLGNDLKGNTEKVIFFNVGVLETLVRLGWKPDIIHCHDWYASLIPLLLK 160
78189764   81 VKVTALPSSKIQTYFLYNEKYFKRHAWFPDLSTGNDARVTVEKIVFFNVGVLETLLRLGWKPDIIHCNDWHTALIPLLLK 160
21674823   81 IKVTALPSSKIQTYFLYNEKYFKRYGLFSDISLGGDHKGSAERIIFFSVGVMETLVRLGWQPDIIHCHDWHAGLVALLAK 160
119358145  81 VKVTALPSSKIQTYFLYNEKYFKRNGLFTDMHSGNDTKVNTEKIIFFNVGVLETLQRLGWKPDIIHCHDWHASLIPLLLR 160
145219101  81 VKVTALPSSKIQTYFLYNEKYFKRNGLFTDTPVQGELKALAEKVAFFNVGVLETLQRLGWRPDIIHCHDWYASLVPLLLK 160
193211901  81 VKVTALPSSKIQTYFLYNEKHFKRSGLFSDLQLGGDHKGSAEKLIFFSVGVMETLVRLGWQPDIIHCNDWHAGLVPLLAR 160
189347663  81 VKVTALPSSKIQTYFLYNEKYFKRNGLFTDVHNGGDLKGNTEKVIFFNVGVLETLQRLGWKPDIIHCHDWYAGLLPLLLK 160
194334817  81 VKVTALPSSKIQTYFLYNEKYFKRNALFADMQQGSDVKNSLERVVFFNLGVLETLQRLGWKPDIIHCQDWYAGLVPLLLK 160
194335486  81 VKVTALPSSKIQTYFLYNEKYFKRNGLFTDIHNGSDLKGSTDKVVFFNVGVLETLQRLGWKPDIIHCHDWHAALIPLLLK 160
189501162 161 TVYADNAFFKDIRTFLTVHNVHRQGVFPLKSFTKLLPEDLIEGLHVEDGNVNMLFTGMKHVDTVSTTSEKYAGLISSDSA 240
78186108  161 TVYRDHEFFKGIKTVLTIHNAYRQGVLPFKVFEKLLPEEVSGALHRSAENVNMLYTGVENADMLTTTSKLHADEILHDEI 240
78189764  161 TMYASHEFFRNVKTLFSIHNAYRQGNFPLKHFQRLLPDEVCAGLHCVKDEVNLLFTGIDHVELLTTTSPRYAECLRGDTP 240
21674823  161 TRYAKHDFFKKVKVVQTIHNVYRQGVFPSKAFQKHLDPEVCDALDMEGGEVNLLATGIKHADLVTTTSDRYARQLLDDPE 240
119358145 161 TVYASNEFFKDIKTVLTIHNIYRQGILPFKIFQKLLPEEVCSGLHRQNDEVNMLYTGVEHVDLLTTTSKQYADTIRLDGE 240
145219101 161 TVYRDHEFFRGIKTAMTIHNVYRQGVLPFKVLKKLLPDEVCSELHRSGDDVNMLYTGVEHADMLTTTSPSYAEEITGEAG 240
193211901 161 TRYAKHDFFKKVKIVQSVHNVYRQGVFQPKMFQKHLDPEVFDGLEREGDDINLLATGIKYADLVTTTSPSYAKQIASDPE 240
189347663 161 TVYASNSFFSDVKTVLTVHNVYRQGILPFKVFQKLLPEEVSSALYRAGDNVNMLYTGAEHADLLTTTSRLYADEIVGNGS 240
194334817 161 TMYADCEFFKDIRTVLTVHNAYRQGIYPLKGFKKMLPSEVIDKMHVEDDTVNMLFTAVEHFDAVTTTSDAYAGMLADGRS 240
194335486 161 TVYASHEFFRDIKTVFTIHNIYRQGILPMKAFQKLLPEEVSSALHCSNDEVNMLYTGVEHADLLTTTSKVYAEEIVHDGL 240
189501162 241 VSCGADKVLNSRGMHPQGITNGLDSKQWNPSSDKLIKKKFDIERLDEKRENKKFLLESLIMPFDEETPLIGAMIHFDRFQ 320
78186108  241 PGCGLQQILAGQNGILHGIVNGIDTRQWNPSTDKLIKKRFATDRMDGKLDNRAALSEEVHMPFEDGRPVVGVIMHFDDFQ 320
78189764  241 EAFGVGKRLLERELPLHGMVNGLDARQWNPAIDKMIKKRYSTENMNGKVENRKMLLEEMKLPWRDGMPLVGFIATFDDYQ 320
21674823  241 LSFGMDKALKACGDRFHGILNGMDTRQWNPSSDKLIKKRYSAEQPEMKLEDKKVLLEEVGLPFSEETPVVGVIGSFDQYQ 320
119358145 241 ETYGLGRILEERKENLHGILNGIDTRQWNPATDKLIKKRYSIERLDGKADNKKALQEEAGLSVDAERPLVGVIAGFDEFQ 320
145219101 241 NAFGLSEVLGERNMTLHGIVNGIDTRQWNPSTDKLIKKRYAPERMEGKTENKRALLEEIKLSPDTDRPVVGVIINFDEFQ 320
193211901 241 SSFGMDKALKACKDRFHGILNGMDTRQWNPSSDKLIKKRYSAAQPELKLEDKKVLLEEVGLPFSEETPVVGVITTFDDVQ 320
189347663 241 DTYGLGTVVEERKSTFHGILNGIDTRQWNPSTDKLIKKRYAADRLEGKLDNKKALLDEAGLPFTEGRPLAGIIIGFDAFQ 320
194334817 241 EAFGLDRVIEKRASGLVGIANGLDAKQWNPAADKMIKKKFDIERLSEKTENKKYLLEEFGMELEEATPLVGSVINAERFQ 320
194335486 241 QTYGLGRVLEEHQAKFYGILNGIDSRQWNSAADKLIKKRYSLEHMDGKLDNKKALLEEAGLPYTEGTPVVGVILNFDEFQ 320
189501162 321 GIDLLIESIDRLMELDLQLVICGSGSKEVQSKLHALAKEYEGRIGLDFEFTDAGFHQLMAAVDMLLIPGKSESCGMQQFF 400
78186108  321 GAVLIEKSLKKLVALDIHLLICGAGDKKYEKSFRDFADAHPDRVSLSTDCPESFLHLAIAGLDMLVMAGKIESCGMLQMF 400
78189764  321 GAKLLADSLEKLIAQDIQLVIIGFGDKKCEQRFQEFVVAHPEQVSVQAECSDSFLHLAIAGLDLLLMPSKVESCGMLQMS 400
21674823  321 GAEIVKASLAKLLELDIQLIVFGSGDKEFDQALKETAEENEEKMAFRPEFTDAFYHQMIAGLDILLMTSRIEACGMMQMF 400
119358145 321 GADLLARSLEKLVALDMQLVICGSGDKVYEKTFRDFAEQYPEQVSLQIEYTDAFMHLAIAGMDILLMPGRIESCGMMQLF 400
145219101 321 GAGLIAGSLKKLAAMDIQLVICGSGDQKYEKQFREFADAHPETVSLHTDCPDSFIHLAIAGFDILLMPGKIESCGMLQMF 400
193211901 321 GMGLLKESLSKLLELDLQLIVSGSGNKEFEQELRDLVEEHPEKLAVNTDFTDAFYHQMIAGLDMLIMPSRIESCGMKQMF 400
189347663 321 GAELLKESLVKLVELDMQLIICGSGDKEYEKYFQDFAAEYPEQVSVRTDYADTLLHLAIAGFDMLLMPGRIESCGMLQLF 400
194334817 321 GSELLMESIDGLMELDIQLVVSVSGDKELIRRLQEKAKAYPEKLAVYSEFSDAIFHQIMASSDLLLIPAEVESCGMMQLF 400
194335486 321 GAELLQQSLEQLAALDIQLIISGSGDKKYEKVFQDFALEHPEQVSVHGEYSDSFFHLAIAGLDILLMPGMIESCGMIQMF 400
189501162 401 AMRYGAVPVVNAGGGISETIVEIDARSdGSGFVFHDYTPASLVEKIGEALAVYGDQERWETLVKENMERRLTWKKSAKKY 480
78186108  401 AMSYGTIPVAYAGGGIVETIDEVSEGG-GSGFIFREYTPDALVSKLHEAIGLYHDSERWQELVMRAMTRDFAWKGAAEEY 479
78189764  401 AMTYGTIPIARATGGIVETIQDHGENL-GTGFLFDDYSVEGLSGRLADALRCFHDDECWPALVERAMSSDFSWHNTAEAY 479
21674823  401 AMNYGTVPVAYAGGGIVDTIEEVSGDK-GTGFIFTDYTPEALTAKLQEALALFANRERWSALMLECMGRDFSWSTSAGQY 479
119358145 401 AMSYGTIPVVYAGGGIIETIHELQEGI-GSGFIFHEYTDDSLVGKLSEALAMYSDEERWPQLVHEAMSKDFAWKSSAEEY 479
145219101 401 AMSYGTIPVAFAGGGIVETIDDYSEKD-GYGFIFHDYTPKALVARLGAAVALYHDSERWKEIVGRAMARDFGWKHSAEEY 479
193211901 401 AMNYGTVPIAYAGGGIVETIEEVSGDK-GTGFVFTDYTAEALTAKLGEALSMFDDKERWAELMREGMERDFSWSASAEQY 479
189347663 401 AMSYGTIPVAYAGGGIVETIDAVTDKS-GSGFLFYDYTADAFAGKVQEALDLYHDEERWLQLVLEAMGKDFSWKNSAGEY 479
194334817 401 AIAYGSVPVVYTAGGNIETIEEIAGDKnGSAFVFHEYSVESLLATFEDALHTYADGERWERIVTGNMVRDLTWKNSAAKY 480
194335486 401 AMNYGTIPVAYAGGGIVETIEERDEES-GSGFIFHDYSAESLVGKLEEALACFHDEESWQQIVMTAMTRDFTWKKSAEEY 479
189501162 481 NQLYSDLLER 490
78186108  480 AGLYRELLGN 489
78189764  480 GQLYRNLLGK 489
21674823  480 AELYRNLLG- 488
119358145 480 DQLYRQLLEP 489
145219101 480 GGLYRELLES 489
193211901 480 AELYREILG- 488
189347663 480 DQLYRKLLEE 489
194334817 481 NELYQGVRGG 490
194335486 480 DQLYRELLEP 489
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap