Conserved Protein Domain Family
psbM

?
PRK14094: psbM 
photosystem II reaction center protein PsbM
Statistics
?
PSSM-Id: 172584
View PSSM: PRK14094
Aligned: 9 rows
Threshold Bit Score: 63.4527
Threshold Setting Gi: 33239809
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
72383529   1 METTSFGFAASLLFVGVPTIFLIGLFVSTSDGEKSSFYSDTSKGRLSPEP 50 
78778708   1 METTNFGFIASLLFVGVPTIFLIGLFISTQDGEKSSFFSDSSKGKLGPKR 50 
33239809   1 METTNFGFIISLLFVGIPTIFLVGLYISTSDGEKSSFFSDSSKGKLGPKS 50 
33860875   1 METTNFGFVASLLFVGIPTIFLIGLFISTQDGEKSSFYSDSSKGKLGPKR 50 
126695680  1 METTNFGFVASLLFVGVPTIFLIGLFISTQDGEKSSFYSDSSKGRLGPKR 50 
123965584  1 METTNFGFVASLLFVGVPTIFLIGLFISTQDGEKSSFYSDSGKGKLGPKR 50 
123967878  1 METTNFGFVASLLFVGVPTIFLIGLFISTQDGEKSSFYSDSSKGRLGPKR 50 
124025120  1 METTSFGFAASLLFVGVPTIFLIGLFVSTSDGEKSSFYSDTSKGRLSPEP 50 
157412679  1 METTNFGFVASLLFVGVPTIFLIGLFLSTQEGEKSSFYSDSGKGKLDPKR 50 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap