Conserved Protein Domain Family
PRK14092

?
PRK14092: PRK14092 
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
Statistics
?
PSSM-Id: 172582
View PSSM: PRK14092
Aligned: 5 rows
Threshold Bit Score: 249.878
Threshold Setting Gi: 163855126
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
33603038    1 MNGSPASALAYVGLGANLGDAAATLRSVLAELAAAPGILACKASRLYRTAPVDAQGPDFVNAVAALDTTLAPLDLLDLLQ 80 
33598145    1 MNGSPASALAYVGLGANLGDAAATLRSVLAELAAAPGILACKASRLYRTAPVDAQGPDFVNAVAALDTTLAPLDLLDLLQ 80 
33591479    1 MNGSPASTLAYVGLGASLGDAAATLRSVLAELAAAPGILACKASRLYRTAPVEAQGPDFVNAVAALDTTLAPLDLLDLLQ 80 
163855126   1 ---MTHTARAYIGLGANLGDAQATLRAVLHELAATPGILACRSSSLYRSAPVDAAGPDFINAVAAIDTTLAPLALLDALQ 77 
187477228   1 -----MSVRAYIGLGANLGDGPATLRAVLAEISALPGVRRCEASPFYRSAPVEASGPDFTNAAAALDTTLTPLELLDALL 75 
33603038   81 ALEQRHGRERPYRNAPRTLDLDLLLYGEQAIDHPRLSVPHPRMHERAFVLAPLCELAPALRLAQGDCAALLAALEDQAIE 160
33598145   81 ALEQRHGRERPYRNAPRTLDLDLLLYGEQAIDHPRLSVPHPRIHERAFVLAPLCELAPGLRLAQGDCAALLAALEDQAIE 160
33591479   81 ALEQRHGRERPYRNAPRTLDLDLLLYGEQAIDHPRLSVPHPRMHERAFVLAPLCELVPALRLAQGDCAALLAALEDQAIE 160
163855126  78 ALETRHGRERPYKNAPRTLDLDLLLYGDTAMDTPRLCLPHPRMHQRAFVLAPLGELAPELVLPQGPLQTLLAQLADQSIE 157
187477228  76 DLERSHGRQRPYKNAPRTLDLDLLIYGDLVMDTPRLVLPHPRLHERAFVLYPLRDIAPTLRFAQGAYCDLLRALDDQAIE 155
33603038  161 PLR 163
33598145  161 PLR 163
33591479  161 PLR 163
163855126 158 RLP 160
187477228 156 RL- 157
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap