Conserved Protein Domain Family
dnaA

?
PRK14088: dnaA 
chromosomal replication initiator protein DnaA
Statistics
?
PSSM-Id: 172578
View PSSM: PRK14088
Aligned: 7 rows
Threshold Bit Score: 771.307
Threshold Setting Gi: 239616412
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
239616412   1 MSNRIISILKKRLARKTWDNWFTTFQVKKVTDDKIIFSVGNLFIKDWLQSKYGSVISKAIKEAYGKNLDYEIVYETTEPe 80 
15643688    1 MKERILQEIKTRVNRKSWELWFSSFDVKSIEGNKVVFSVGNLFIKEWLEKKYYSVLSKAVKVVLGNDATFEITYEAFEP- 79 
170287808   1 MKERILQEIKTRVNRKSWELWFSSFDVKSIEGNKVVFSVGNLFIKEWLEKKYYSVLSKAVKVVLGNDATFEITYEAFEP- 79 
157362871   1 MKSEIIESLKSKLNRRVWESWFGTFDVKEIGPDYVVFQVGNLFIREWLEKKYGSLISKTLRELFGKPMDFRIEHASAKTe 80 
148269146   1 MKERILQEIKTRVNRKSWELWFSSFDVRSIEGNKVVFSVGNLFIKEWLEKKYHSVLSKAVKVVLGNDATFEITYEAFEP- 79 
222100623  11 MKERILQEIKTRVNRKSWELWFNSFEVKTIEGNKVIFSVGNLFIKEWLEKKYHSVLSRAVKTVLGHDATYELTYESFDS- 89 
281411445   1 MKERILQEIKTRVNRKSWELWFSSFDVKSIEGNKVVFSVGNLFIKEWLEKKYYSVLSKAVKVVLGNDATFEITYEAFEP- 79 
239616412  81 afnksNESYKGPLVKKKPLLISNLNANYTFENFVVGPENRVLYEVSLEISRNPGRYNPFFVYGMVGLGKTHLLQAIAHKI 160
15643688   80 -----HSSYSEPLVKKRAVLLTPLNPDYTFENFVVGPGNSFAYHAALEVAKHPGRYNPLFIYGGVGLGKTHLLQSIGNYV 154
170287808  80 -----HSSYSEPLVKKRAVLLTPLNPDYTFENFVVGPGNSFAYHAALEVAKHPGRYNPLFIYGGVGLGKTHLLQSIGNYV 154
157362871  81 e--klDSNEDEPLVKKRPLILTPLNPILTFENFVVGPNNMFAYSTCLEVAKNPGKYNPLFLHGGVGLGKTHLLQAIGHYL 158
148269146  80 -----HSSYSEPLVKKRAVLLTPLNPDYTFENFVVGPGNSFAYHAALEVAKHPGRYNPLFIYGGVGLGKTHLLQSIGNYV 154
222100623  90 -----HTSYSEPLVKKKAVLLTPLNPAYTFENFVVGPGNSFAYHASLEVAKNPGKYNPLFIYGGVGLGKTHLLQSIGNYI 164
281411445  80 -----HSSYSEPLVKKRAVLLTPLNPDYTFENFVVGPGNSFAYHAALEVAKHPGRYNPLFIYGGVGLGKTHLLQSIGNYV 154
239616412 161 MELHPEMRVLYITSEQFMNDMIDSIKYGSVRDFREHYRKKADVLLIDDIQFLIGKNGVQKELFHTFNELYDAGKQIVICS 240
15643688  155 VQNEPDLRVMYITSEKFLNDLVDSMKEGKLNEFREKYRKKVDILLIDDVQFLIGKTGVQTELFHTFNELHDSGKQIVICS 234
170287808 155 VQNEPDLRVMYITSEKFLNDLVDSMKEGKLNEFREKYRKKVDILLIDDVQFLIGKTGVQTELFHTFNELHDSGKQIVICS 234
157362871 159 FKHEPDMRVIYLTSERFLNELVDSIKKNRVQEFRDKFRNKIDVLLLDDVQFLIGKTGIQTELFHTFNELYNEGKQIVVCS 238
148269146 155 VQNEPDLRVMYITSEKFLNDLVDSMKEGKLNEFREKYRKKVDILLIDDVQFLIGKTGVQTELFHTFNELHDSGKQIVICS 234
222100623 165 VQREPDLRVMYITSEKFLNDLVDSMKEGKLAEFREKYRKKVDVLLIDDIQFLIGKTGVQTELFHTFNELHDSGKQIVICS 244
281411445 155 VQNEPDLRVMYITSEKFLNDLVDSMKEGKLNEFREKYRKKVDILLIDDVQFLIGKTGVQTELFHTFNELHDSGKQIVICS 234
239616412 241 DRNPEELNGFHDRLVSRFQMGMVMEICPPEKDTRFKIAKKFAERESVSLPDDVAQLLADSVDGNLRILRGVIIKLIVQSS 320
15643688  235 DREPQKLSEFQDRLVSRFQMGLVAKLEPPDEETRKSIARKMLEIEHGELPEEVLNFVAENVDDNLRRLRGAIIKLLVYKE 314
170287808 235 DREPQKLSEFQDRLVSRFQMGLVAKLEPPDEETRKSIARKMLEIEHGELPEEVLNFVAENVDDNLRRLRGAIIKLLVYKE 314
157362871 239 DRDPQQLEKFQDRLVSRFQMGVVTKIEKPDEETCFKIAQKMAQLENAELQEDILKLISKNFSDNLRRLRGALVKLIMYQQ 318
148269146 235 DREPQKLSEFQDRLVSRFQMGLVAKLEPPDEETRKSIAKKMLEIEHGELPEEVLNFVAENVDDNLRRLRGAIIKLLVYKE 314
222100623 245 DREPHMLKEFQDRLISRFQMGLVAKLEPPDRETRKSIARKMLEVEEGELPEEVLDFVAENVDDNLRRLKGAIIKLLVYKE 324
281411445 235 DREPQKLSEFQDRLVSRFQMGLVAKLEPPDEETRKNIARKMLEIEHGELPEEVLNFVAENVDDNLRRLRGAIIKLLVYKE 314
239616412 321 INKERIGAALTNQILAAFNKTTvSIKRMKEEDLIMSTIEAVMGVSPEEIKGTSRKQNIVLSRQLLMYILKRHHGKSIKEI 400
15643688  315 TTGKEVDLKEAILLLKDFIKPN-RVKAMDPIDELIEIVAKVTGVPREEILSNSRNVKALTARRIGMYVAKNYLKSSLRTI 393
170287808 315 TTGKEVDLKEAILLLKDFIKSN-RVKAMDPIDELIEIVAKVTGASREEILSNSRNVKALTARRIGMYVAKNYLKSSLRTI 393
157362871 319 ISGEKVDLQKAFELLA--IQNS-YHNKSLPEEKLMNSICEIFGVSQEEILSKSRKKEVALARQIGMYVARNYMGFSLRKV 395
148269146 315 TTGKEVDLREAILLLKDFIKPN-RVKAMDPIDELIEIVAKVTGVSREEILSNNRNVKALTARRIGMYVAKNHLNSSLRTI 393
222100623 325 TTGREVDLKEAIALLKDFIKPE-RKPILDPIDELIEIVSRVMDVPKEEILSSSRNAKALMARRIGMYIAKTYLKSSLRTI 403
281411445 315 TTGKEIDLKEAILLLKDFIKSN-RVKAMDPIDELIEVVAKVTGVPREEILSSSRNVKALTARRIGMYVAKNYLKSSLRTI 393
239616412 401 SKITGKRHSTVIHSIKKIEMSVIKGNTVVKEKLAKILNTMATSSAAG 447
15643688  394 AEKFNRSHPVVVDSVKKVKDSLLKGNKQLKALIDEVIGEISRRALSG 440
170287808 394 AEKFNRSHPVVVDSVKKVKDSLLKGNKQLKALIDEVIGEISRRALSG 440
157362871 396 ADMFKRSHPTVSHTIQKLEELTNSGNMVIKSQIDRLARCVTGQILDQ 442
148269146 394 AEKFNRSHPVVLDSVKRVKDSLLKGNKQLKSLIDEVIGEISKRALSG 440
222100623 404 AEKFNRSHPVVADSVKKVKNSLLKGNRQLKMYIDEIVGEISHRASSG 450
281411445 394 AEKFNRSHPVVVDSVKKVKDSLLKGNKQLKALIDEVIGEISRRALSG 440
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap