Conserved Protein Domain Family
dnaA

?
PRK14087: dnaA 
chromosomal replication initiator protein DnaA
Links
?
Statistics
?
PSSM-Id: 172577
View PSSM: PRK14087
Aligned: 3 rows
Threshold Bit Score: 650.084
Threshold Setting Gi: 50364816
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
42560561  30 MNVNDILKELKLNLMANKNIDESVYNDYIKTINIHKKGFSDYIVVVKSQFGLLAIKQFRQTIKNEIKNILKEPVNISFTY 109
50364816   1 METKALWEKLINKLKKEKLIDQDIIEEYIVTSELIKISNTEFVILVRSNLGVTILNEFKEVFVYEFKSVLNSYVSVDFLT 80 
83319700   1 MNLNDILKELKLSLIANKNIDESVYNDYIKTINIYKKDLSNYVVVVKSQFGLLAIKQFRPTIENEIKKILKQPVNISFTY 80 
42560561 110 EQEYKKQLEKDEliKKDHSDIITKKvkkiNENTFENFVIGASNEQAFIAVQTVSKNPGISYNPLFIYGESGMGKTHLLKA 189
50364816  81 KEIFEKNTKKEN--KKEPINTVLSE----NALTFENFIVGSSNKQANLAAKNVVANPGMSFNPLFIYGDSGLGKTHLLQA 154
83319700  81 EQEYQKQLEKTEsiNKDHSDIISKKnkkvNENTFENFVIGSSNEQAFIAVQTVSKNPGISYNPLFIYGESGMGKTHLLKA 160
42560561 190 AKNyiESNFSDLKVSYMSGDEFARKAVDILQKTH-KEIEQFKNKICQNDVLIIDDVQFLSYKEKTNEIFFTIFNNFIEND 268
50364816 155 IKN--QAELNGKKVLYLTSEEFTKRIVNALNKGDlSEIEELKTEINSNEFFILDDVQFLSKKDKTNEFFFNIINNFTENG 232
83319700 161 AKNyiESNFSDLKVSYMSGDEFARKAVDILQKTH-KEIEQFKNEVCQNDVLIIDDVQFLSYKEKTNEIFFTIFNNFIEND 239
42560561 269 KQLFFSSDKSPELLNGFDNRLITRFNMGLSIAIQKLDNKTATAIIKKEIKNQNIKSEVTSEAINFISNYYSDDVRKIKGS 348
50364816 233 KQLVFSSDKTPELLNGFDKRMITRFNSGLSTPINALDIPTAKLIIEAEIKKQGLKQKIKEDAVVYLAQNFSDDVRKIKGL 312
83319700 240 KQLFFSSDKSPELLNGFDNRLITRFNMGLSIAIQKLDNKTATAIIKKEIKNQNIKTEVTNEAINFISNYYSDDVRKIKGS 319
42560561 349 VSRLNFWSQQNPEEKIITIEIVSDLFRDIPTSKLGILNVKKIKEVVSEKYGISVNAIDGKARSKSIVTARHIAMFLTKEI 428
50364816 313 VNRLLFFGIQNDLGHIIDLEDVIDLFKDTPSANLGLLNVKKIKEVVAKKYDVTIKAIDGKARTTAIKNARHLSMYFAKII 392
83319700 320 VSRLNFWSQQNPEEKVITIEIISDLFRDIPTSKLGILNVKKIKEVVSEKYGISVNAIDGKARSKSIVTARHIAMYLTKEI 399
42560561 429 LNHTLAQIGEEFGGRDHTTVINAERKIETMLKKDKQLKKTVDILKNKILTK 479
50364816 393 LNHTSTQIGAEFGGRDHSTVLSAISRIEKLIYKEKEFKKIVESLKNEIIGK 443
83319700 400 LNHTLAQIGEEFGGRDHTTVINAERKIEMMLKKDKQLKKTVDILKNKILTK 450
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap