Conserved Protein Domain Family
pnk

?
PRK14077: pnk 
NAD(+) kinase
Statistics
?
PSSM-Id: 172567
View PSSM: PRK14077
Aligned: 9 rows
Threshold Bit Score: 498.537
Threshold Setting Gi: 154148323
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
154148323   1 MENLMQnfklHENVKSIGLIAKKSAEIGALIDKITKILKAKNIEILIEKNSADFFGKAGFGLNEILKKTEILISLGGDGT 80 
57236954    1 MQNKID----YKNIKKIGLVTRPNVSLDKEILKLQSILSIYKVELVLLKESSEILDLPKYGLDDLFKISDFVISLGGDGT 76 
157414920   1 MQNKID----YKNIKKIGLVTRPNVSLDKEILKLQSILSIYKVELVLFKESSEILDLPKYGLDDLFKISDFVISLGGDGT 76 
157165192   3 NEQKFN----TTNAKKVGLIAKDYPLFKQDLAKLEKILKKYNAEILLEKSCAKQVEKSGFELIKLAKECEFLITLGGDGT 78 
121613722   1 MQNKID----HKNIKTIGLVTRPNVSLDKEILKLQSILSIYKVELVLFKESSEILDLPKYGLDDLFKISDFVISLGGDGT 76 
118474358   1 --MIEI----HKNLKAVGILTRNAIDQKDAINTLKKILEKYEVSVLLEHHIAAELNEVGCSLDEMLKNTNLIISVGGDGN 74 
154173788   1 MKKDIN----IKTIKKVGIVAKSSPELVQNLKTIEKILSGYGVEILLESAVAKELNLNGYETGELARNCDFLISLGGDGT 76 
153952170   1 MQNKID----HKNIKKIGLVTRPNVSLDKEILKLQSILSIYKVELVLFKESSEILDLPKYGLDDLFKISDFVISLGGDGT 76 
218562291   1 MQNKID----YKNIKKIGLVTRPNVSLDKEILKLQSILSIYKVELVLLKESSEILDLPKYGLDDLFKISDFVISLGGDGT 76 
154148323  81 LISIAGKVANQNAFIIGIHAGTLGFLTDILPDDFEKFLDEFLRGEYEIERPFMLEVLFEKNSGEIVRKLAFNDVVLNRNN 160
57236954   77 LISLCRKACEYDKAVLGIHAGHLGFLTDFKVDEAENFFQAFFQGEFRIEKPYLLSVFLEDKQGKILEKLAFNDVVISKNN 156
157414920  77 LISLCRKACEYDKAVLGIHAGHLGFLTDFKVDEAENFFQAFFQGEFRIEKPYLLSVFLEDKQGKILEKLAFNDVVISKNN 156
157165192  79 IISTCRKLAHISPLILGIHAGRLGFLTDITINESEKFFKDFFDDKFEVETPFMLDVTLHKNDGKTEQKIAFNDAVIVSKN 158
121613722  77 LISLCRKACEYDKAVLGIHAGHLGFLTDFKVDEAENFFQAFFQGEFRIEKPYLLSVFLEDKQGKILEKLAFNDVVISKNN 156
118474358  75 FISTCRKCASSGVFVFGVHTGHLGFLTDVTLNQCDKFFEEFFRGCYEIEKPYMLEAKF-KKDDKIMEKLAFNDIVLMRRK 153
154173788  77 IISLCRQTAEISPFVLGIHAGRLGFLTDITMNECEKFFADFFSGKFEVEKPHMLDVFLHEKSGKTLQKIAFNDAVIVSAK 156
153952170  77 LISLCRKACEYDKAVLGIHAGHLGFLTDFKVDEAENFFQAFFQGEFRIEKPYLLSVFLEDKQGKILEKLAFNDVVISKNN 156
218562291  77 LISLCRKACEYDKAVLGIHAGHLGFLTDFKVDEAENFFQAFFQGEFRIEKPYLLSIFLEDRQGKILEKLAFNDVVISKNN 156
154148323 161 IASMAKIDAYLNRKYFNTYFGDGVIISSAVGSTAYNMSANGPIIYPLSDVFCITPICSHSLTQRPLIVPKEYFVNFKTKs 240
57236954  157 QASMAHIEVFRKEKKFNEYFGDGLIVATPAGSTAYNLSANGPIVYTLAQAFILTPVCSHSLTQRPIVLPKGFEIEIMAK- 235
157414920 157 QASMAHIEVFRKEKKFNEYFGDGLIVATPAGSTAYNLSANGPIVYTLAQAFILTPVCSHSLTQRPIVLPKGFEIEIMAK- 235
157165192 159 GGSMTHIEALLNEKYFNSYFGDGVIVATPAGTTAYNMSANGPIIYPLSEVFTVTPICSHSLTQRPVVLTKNHTVKFRTKs 238
121613722 157 QASMAHIEVFRKEKKFNEYFGDGLIVATPAGSTAYNLSANGPIVYTLAQAFILTPVCSHSLTQRPIVLPKGFEIEIMAK- 235
118474358 154 IDSTSNIEAFLNSKYFNSYFGDGVIISSAMGSTAYNMSAGGAIIYPLCDVFSLTPVCSHSLTQRPLILPKEFKVEFKSCd 233
154173788 157 SAAMTQIEACLNGKYFNYYFGDGVIIATPVGTTAYNMSANGPIIYPLSEVFTVTPICSHSLTQRPVVLPHDFEVKFKTSs 236
153952170 157 QAPMAHIEVFRKEKKFNEYFGDGLIVATPAGSTAYNLSANGPIVYTLAQAFILTPVCSHSLTQRSIVLPKGFEIEIMAK- 235
218562291 157 QASMAHIEVFRKEKKFNEYFGDGLIVATPAGSTAYNLSANGPIVYTLAQAFILTPVCSHSLTQRPIVLPKGFEIEIMAK- 235
154148323 241 DVSAIVDGQDIFNMNEFKNIGVRVNKARSSLIRRVNHDYFGILREKLSWGK 291
57236954  236 DCILCIDGQENYKMNDFKSIKVGLSDKNVALIHPKNRDYFQILKEKLHWGN 286
157414920 236 DCILCIDGQENYKMNDFKSIKVGLSDKNVALIHPKNRDYFQILKEKLHWGN 286
157165192 239 DAILVIDGQDRFDMSKISAVSMSLSDKKARLIRHIGRDYFQILKEKLHWGY 289
121613722 236 DCILCIDGQENYKMNDFKSIKVGLSDKNVALIHPKNRDYFQILKEKLHWGN 286
118474358 234 DVVVLIDGQDRVDLKNYTSVEVGISDVRVNLIRHKDRDYFEILKQKLRWGH 284
154173788 237 DAMLVIDGQDRYKMSNLTAVSARLSDKSARLIRHVGRDYFQILKEKLHWGY 287
153952170 236 DCILCIDGQENYKMNDFKSIKVGLSDKNVALIHPKNRDYFQILKEKLHWGN 286
218562291 236 DCMLCIDGQENYKMNDFKSIKVGLSDKNVALIHPKNRDYFQILKEKLHWGN 286
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap