Conserved Protein Domain Family
rpsF

?
PRK14074: rpsF 
30S ribosomal protein S6; Provisional
Links
?
Statistics
?
PSSM-Id: 172564
View PSSM: PRK14074
Aligned: 4 rows
Threshold Bit Score: 466.742
Threshold Setting Gi: 190571063
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
58584757    1 MNLYEFTFIAQQGLLQQEVEGMAQELGVSLKNIKADIMFQQIKGILEKGSDKFTKRDSEMHAKDIQENLIAYSSFLESFA 80 
190571063   1 MNLYEFTFIAQPNLLQQEVEEMVQELAILLKNIKADVISQEVKGLIEREHSTVTKQELEASTESIKKSLIVYSDFLETLT 80 
161378181   1 MNLYEFTFIAQQGLLQQEVEEMVQELAVSLKNIKADIMFQQIRDILKKGNDKLTKQELEVRAEDIKESLVAYSDFLEDLT 80 
225630394   1 MNLYEFTFIAQQGLLQQEVEEMVQELAVLLKNIKTDVMFQQIRDILKKGNDKLTKQELEVRAENIKESLVAYSDFLEDLT 80 
58584757   81 KILWIELEEDLSNLKEVKLKISKELKDDLKGLGIAQGFIKLPEGGkqiAKNAFIHNAVSALKEDISKHLIKIFQGILQNF 160
190571063  81 KILWVELEEDFSNLKEIKSRIDKELKNELSDTGIKQNFMDLPGAN---IKSAFIYNVVNAFKENISQHLIKPLQEVLKSF 157
161378181  81 KILWVELEEDLSNLKEVKSKIDKELKDDLKDLGITQDFTKFLGGS---TKSAFIHNAVNALKRNISEHLIKIFQDILKDF 157
225630394  81 KILWVELEEDLSNLKEVKSKIDKELKDDLKDLGITQDFTKFLGGS---TKSAFIHNAVNALKRNISEHLIKIFQDILKDF 157
58584757  161 GMAEPNQSNKTLEMLLDNIEASGLIKYEYWGLLDFAYPINKMKSGHYCIMCISSTSNIMDEFVRRIKLNENIIRHLSVHV 240
190571063 158 KIVDSNQLNKTLEVLLKNIEASGLIKYEYWGLLDFAYPINKMKSGHYCMMCISFTSSIMDEFERRVKLNENIIRHLSVRV 237
161378181 158 RINGPTQSSKALEMLLKNIEASGLIKYEHWGLLDFAYHKNKMKSGHYCIMCISSTASILDEFMRRMKLNENVIRHFPVQV 237
225630394 158 RINGPTQSSKALEMLLKNIEASGLIKYEHWGLLDFAYHTNKMKSGHYCIMCISSTASILDEFVRRMKLNENVIRHFPVQV 237
58584757  241 DKFFEGKSHMMNKQVEEQSA 260
190571063 238 NEFFKGKSYMMDKQIEEKSA 257
161378181 238 DKIFEGKSHMMNKQIEEQSA 257
225630394 238 DKIFEGKSYMMNKQIEEQSA 257
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap