Conserved Protein Domain Family
PRK14069

?
PRK14069: PRK14069 
exodeoxyribonuclease VII small subunit; Provisional
Statistics
?
PSSM-Id: 172559
View PSSM: PRK14069
Aligned: 6 rows
Threshold Bit Score: 97.0142
Threshold Setting Gi: 189911336
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
116330898  1 MAEARSKISFEDALVELEQIAEKLERQDFSLEESLKAYERGMELKKICRGILDSAEGKIEALTKDESQKTNKTGFRTESK 80 
116328174  1 MAEARSKISFEDALVELEQIAEKLERQDFSLEESLKAYERGMELKKICRGILDSAEGKIEALTKDESQKTNKTGFRTESK 80 
24215057   1 MVETKSKISFEDALMELEQIAEKLERQDFSLEESLKAYERGMELKKICQGILDTAEGKIEALTKDESKKTNKTGFRGESK 80 
45657462   1 MVETKSKISFEDALMELEQIAEKLERQDFSLEESLKAYERGMELKKICQGILDTAEGKIEALTKDESKKTNKTGFRGESK 80 
189911336  1 MVDKKT-ISFEEAIRELEDIAEKLERGTLSLEDSIKAYERGMELKKICSERLVDAEAKIEFLTKAPNGEVVKSTVKK--- 76 
183221245  1 MVDKKT-ISFEEAIRELEDIAEKLERGTLSLEDSIKAYERGMELKKICSERLVDAEAKIEFLTKAPNGEVVKSTVKK--- 76 
116330898 81 sTSQTSSDSVLEEDLF 96 
116328174 81 sTSQTSSDSVLEEDLF 96 
24215057  81 -TTETKNNTAQEEDLF 95 
45657462  81 -TTETKNNTAQEEDLF 95 
189911336 77 -KKDESPSKQAEEDLF 91 
183221245 77 -KKDESPSKQAEEDLF 91 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap