Conserved Protein Domain Family
PRK14067

?
PRK14067: PRK14067 
exodeoxyribonuclease VII small subunit; Provisional
Statistics
?
PSSM-Id: 172557
View PSSM: PRK14067
Aligned: 5 rows
Threshold Bit Score: 105.668
Threshold Setting Gi: 46579759
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
78357245    1 MTGTGTTGFEEQLARLQEIVRRLETGELPLEEGVALYKEGLELAAGCRKRLQTARNDIKVFSDGVLKDFDMPEDSPAADD 80 
46579759    2 AGRKKAADFEQQLARLQEIVDALEGGDLPLEKSVALYKEGLGLARASREQLAKARNEIRLFTEGEVRDFDPEEGDDGDDR 81 
120602764   2 AGRKKAADFEQQLARLQEIVDALEGGDLPLEKSVALYKEGLGLARASREQLAKARNEIRLFTEGEVRDFDPEEGDDGDDR 81 
218885232  22 EQAGVTVDYEAAMARLQEVVAALEAGDLPLERSVALYKEGLSLSRACRDRLRTARNEIRLFTEGDLKDFEGVRDDADAE- 100
242278214   1 -MTKDNKTFEDRLDRLKAIVSALEKGDLPLEEGVALFKEGQTLSKECATQLEKARNEVKIVTGGEVEDFDVDTEEDTADD 79 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap