Conserved Protein Domain Family
PRK14066

?
PRK14066: PRK14066 
exodeoxyribonuclease VII small subunit; Provisional
Statistics
?
PSSM-Id: 172556
View PSSM: PRK14066
Aligned: 8 rows
Threshold Bit Score: 94.9049
Threshold Setting Gi: 39996865
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
197117644  1 MAVEKFETALKKLEDVVKKLEGGELSLEESLKAFEEGVKFSAFCSKKLNEAERRVETLVKQRDGSFVTKPFEEEE 75 
189425243  1 MAAEKFETSLKKLEEVVRKLEGGSLSLDDSIKAFEEGVKHAAFCAKKLDEAERKVEVLIKQRDGSFRKEPFTTDN 75 
118580819  1 MATEKFETALKKLEEIVRRLEGGSLSLDESLKAFEEGVRHASFCSKKLDEAERRVEVLLKRKDGSFSREPFQPDE 75 
148264231  1 MAVEKFETALKKLEEVVKKLEGGELPLEDSLKAFEEGVKQAAFCSKKLNEAEKRVELLLKQKDGSFAREEFRLDD 75 
39996865   1 MAVEKFETALKKLEDVVRKLEGGDLSLDDSLKAFEEGVKMASFCTKKLDEAEKKVELLLKKKDGTFVREDFRLDD 75 
78223143   1 MAVEKFETALKKLEDVVNRLESGELSLDDSLKAFEEGVKMAAFCTKKLDEAEKKVEILLKKKDGSFAKEPFRLED 75 
222055716  1 MAVEKFETALKKLEEVVKKLEGGELSLEDSLKAFEEGIKQAAFCSKKLNEAEKRVEVLLKQKDGRFITEQFQPED 75 
253701625  1 MAVEKFETALKKLEDVVKKLEGGELSLEESLKAFEEGVKFSAFCSKKLNEAERRVETLVKQRDGSFVTKPFEGEE 75 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap