Conserved Protein Domain Family
PRK14064

?
PRK14064: PRK14064 
exodeoxyribonuclease VII small subunit; Provisional
Statistics
?
PSSM-Id: 172554
View PSSM: PRK14064
Aligned: 9 rows
Threshold Bit Score: 102.991
Threshold Setting Gi: 116872793
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
46907588   1 MATKKKTFEEAIAELETIVEALENGSASLEDSLDMYQKGIELTKLCQDKLQSAEKRMAKVVTDAGEEIPFEADGE 75 
16800467   1 MATKKKTFEEAIAELETIVEALENGSASLEDSLDMYQKGIELTKLCQDKLQSAEQRMAKVVTEAGEEIPFEADGE 75 
16803402   1 MATKKKTFEEAIAELETIVEALENGSASLEDSLDMYQKGIELTKLCQDKLQSAEKRMAKVVTDAGEEIPFEADGE 75 
116872793  1 MATKKKTFEEAIAELETIVEALENGSASLEDSLDMYQKGIELTKLCQDKLQTAEKRMAKVVTDTGEEIPFEADGE 75 
217964492  1 MATKKKTFEEAIAELETIVEALENGSASLEDSLDMYQKGIELTKLCQDKLQSAEKRMAKVVTDAGEEIPFEADGE 75 
226223963  1 MATKKKTFEEAIAELETIVEALENGSASLEDSLDMYQKGIELTKLCQDKLQSAEKRMAKVVTDAGEEIPFEADGE 75 
289434643  1 MATKKKTFEEAIAELETIVEALENGSASLEDSLDMYQKGIELTKLCQDKLQTAEKRMAKVVTDAGEEIPFEADGE 75 
284801747  1 MATKKKTFEEAIAELETIVEALENGSASLEDSLDMYQKGIELTKLCQDKLQSAEKRMAKVVTDAGEEIPFEADGE 75 
284994889  1 MATKKKTFEEAIAELETIVEALENGSASLEDSLDMYQKGIELTKLCQDKLQSAEKRMAKVVTDAGEEIPFEADGE 75 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap