Conserved Protein Domain Family
PRK14057

?
PRK14057: PRK14057 
epimerase; Provisional
Statistics
?
PSSM-Id: 172549
View PSSM: PRK14057
Aligned: 15 rows
Threshold Bit Score: 497.669
Threshold Setting Gi: 29143843
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
207859267   1 MNSQFAGLTREACVALLASYPLSVGILAGQWIALHRYLQQLEALNQPLLHLDLMDGQFCPQFTVGPWAVGQLPQTFIKDV 80 
194449770   1 MNSQFAGLTREACVALLASYPLSVGILAGQWIALHRYLQQLEALNQPLLHLDLMDGQFCPQFTVGPWAVGQLPQTFIKDV 80 
194733952   1 MNSQFAGLTREACVALLASYPLSVGILAGQWIALHRYLQQLEALNQPLLHLDLMDGQFCPQFTVGPWAVGQLPQTFIKDV 80 
194445790   1 MNSQFAGLTREACVALLASYPLSVGILAGQWIALHRYLQQLEVLNQPLLHLDLMDGQFCPQFTVGPWAVGQLPQTFIKDV 80 
197250597   1 MNSQFAGLTREACVALLASYPLSVGILAGQWIALHRYLQQLEALNQPLLHLDLMDGQFCPQFTVGPWAVGQLPQTFIKDV 80 
197364852   1 MNSQFAGLTREACVALLASYPLSVGILAGQWIALHRYLQQLEALNQPLLHLDLMDGQFCPQFTVGPWAVEQLPQTFIKDV 80 
56415925    1 MNSQFAGLTREACVALLASYPLSVGILAGQWIALHRYLQQLEALNQPLLHLDLMDGQFCPQFTVGPWAVEQLPQTFIKDV 80 
62182539    1 MNSQFAGLTREACVALLASYPLSVGILAGQWIALHRYLQQLEALNQPLLHLDLMDGQFCPQFTVGPWAVGQLPQTFIKDV 80 
29143843    1 MNSQFAGLTREACVALLASYPLSVGILAGQWIALHRYLQQLEALNQPLLHLDLMDGQFCPQFTVGPWAVGQLPQTFIKDV 80 
16767346    1 MNSQFAGLTREACVALLASYPLSVGILAGQWIALHRYLQQLEALNQPLLHLDLMDGQFCPQFTVGPWAVGQLPQTFIKDV 80 
207859267  81 HLMVADQWTAAQACVKAGAHCITLQAEGDIHLHHTLSWLGQQTVPVIGGEMPVIRGISLCPATPLDVIIPILSDVEVIQL 160
194449770  81 HLMVADQWTAAQACVKAGAHCITLQAEGDIHLHHTLSWLGQQTVPVIGGEMPVIRGISLCPATPLDVIIPILSDVEVIQL 160
194733952  81 HLMVADQWTAAQACVKAGAHCITLQAEGDIHLHHTLSWLGQQTVPVIGGEMPVIRGISLCPATPLDVIVPILSDIEVIQL 160
194445790  81 HLMVADQWTAAQACVKAGAHCITLQAEGDIHLHHTLSWLGQQTVPVIGGEMPVIRGISLCPATPLDVIIPILSDVEVIQL 160
197250597  81 HLMVADQWTAAQACVKAGAHCITLQAEGDIHLHHTLSWLGQQTVPVIGGEMPVIRGISLCPATPLDVIIPILSDVEVIQL 160
197364852  81 HLMVADQWTAAQACVKAGAHCITLQAEGDIHLHHTLSWLGQQTVPVIGGEMPVIRGISLCPATPLDVIIPILSDVEVIQL 160
56415925   81 HLMVADQWTAAQACVKAGAHCITLQAEGDIHLHHTLSWLGQQTVPVIGGEMPVIRGISLCPATPLDVIIPILSDVEVIQL 160
62182539   81 HLMVADQWTAAQACVKAGAHCITLQAEGDIHLHHTLSWLGQQTVPVIGGEMPVIRGISLCPATPLDVIIPILSDVEVIQL 160
29143843   81 HLMVADQWAAAQACVKAGAHCITLQAEGDIHLHHTLSWLGQQTVPVIDGEMPVIRGISLCPATPLDVIIPILSDVEVIQL 160
16767346   81 HLMVADQWTAAQACVKAGAHCITLQAEGDIHLHHTLSWLGQQTVPVIGGEMPVIRGISLCPATPLDVIIPILSDVEVIQL 160
207859267 161 LAVNPGYGSKMRSSDLHERVAQLLCLLGDKREGKIIVIDGSLTQDQLPSLIAQGINRVVSGSALFRDDRLVENTRSWRAM 240
194449770 161 LAVNPGYGSKMRSSDLHERVAQLFCLLGDKREGKIIVIDGSLTQDQLPSLIAQGIDRVVSGSALFRDDRLVENTRSWRAM 240
194733952 161 LAVNPGYGSKMRSSDLHERVAQLLCLLGDKREGKIIVIDGSLTQEQLPSLIAQGIDRVVSGSALFRDDRLVENTRSWRAM 240
194445790 161 LAVNPGYGSKMRSSDLHERVAQLLCLLGDKREGKIIVIDGSLTQDQLPSLIAQGIDRVVSGSALFRDDRLVENTRSWRAM 240
197250597 161 LAVNPGYGSKMRSSDLHERVAQLLCLLGDKREGKIIVIDGSLTQDQLPSLIAQGIDRVVSGSALFRDDRLVENTRSWRAM 240
197364852 161 LAVNPGYGSKMRSSDLHERVAQLLCLLGDKREGKIIVIDGSLTQDQLPSLIAQGIDRVVSGSALFRDDRLAENTRSWRAM 240
56415925  161 LAVNPGYGSKMRSSDLHERVAQLLCLLGDKREGKIIVIDGSLTQDQLPSLIAQGIDRVVSGSALFRDDRLAENTRSWRAM 240
62182539  161 LAVNPGYGSKMRSSDLHERVAQLLCLLGDKREGKIIVIDGSLTQDQLPSLIAQGIDRVVSGSALFRDDRLVENTRSWRAM 240
29143843  161 LAVNPGYGSKMRSSDLYERVAQLLCLLGDKREGKIIVIDGSLTQDQLPSLIAQGIDRVVSGSALFRDDRLVENTRSWRAM 240
16767346  161 LAVNPGYGSKMRSSDLHERVAQLLCLLGDKREGKIIVIDGSLTQDQLPSLIAQGIDRVVSGSALFRDDRLVENTRSWRAM 240
207859267 241 FKVAGDTTFLPSTA 254
194449770 241 FKVAGDTTFLPSTA 254
194733952 241 FKVAGDTTFLPSTA 254
194445790 241 FKVAGDTTFLPSTA 254
197250597 241 FKVAGDTTFLPSTA 254
197364852 241 FKVAGDTTFLPSTA 254
56415925  241 FKVAGDTTFLPSTA 254
62182539  241 FKVAGDTTFLPSTA 254
29143843  241 FKVAGDTTFLPSTA 254
16767346  241 FKVAGDTTFLPSTA 254
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap