Conserved Protein Domain Family
PRK14055

?
PRK14055: PRK14055 
aromatic amino acid hydroxylase; Provisional
Statistics
?
PSSM-Id: 172547
View PSSM: PRK14055
Aligned: 4 rows
Threshold Bit Score: 697.962
Threshold Setting Gi: 16751979
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
16751979   1 MHYCERTLDPKYILKIALKLRQSLSLFFQNSQSLQRAYSTPYSYYRIILQKENKEKQALARHKCISILEFFKNLLFVHLL 80 
15836577   1 MHYCERTLDPKYILKIALKLRQSLSLFFQNSQSLQRAYSTPYSYYRIILQKENKEKQALARHKCISILEFFKNLLFVHLL 80 
15618954   1 MHYCERTLDPKYILKIALKLRQSLSLFFQNSQSLQRAYSTPYSYYRIILQKENKEKQALARHKCISILEFFKNLLFVHLL 80 
33242417   1 MHYCERTLDPKYILKIALKLRQSLSLFFQNSQSLQRAYSTPYSYYRIILQKENKEKQALARHKCISILEFFKNLLFVHLL 80 
16751979  81 SLSKNQREGCSTDMAVVSTPFFNRNLWYRLLSSRFSLWKSYCPRFFLDYLEAFGLLSDFLDHQAVIKFFELETHFSYYPV 160
15836577  81 SLSKNQREGCSTDMAVVSTPFFNRNLWYRLLSSRFSLWKSYCPRFFLDYLEAFGLLSDFLDHQAVIKFFELETHFSYYPV 160
15618954  81 SLSKNQREGCSTDMAVVSTPFFNRNLWYRLLSSRFSLWKSYCPRFFLDYLEAFGLLSDFLDHQAVIKFFELETHFSYYPV 160
33242417  81 SLSKNQREGCSTDMAVVSTPFFNRNLWYRLLSSRFSLWKSYCPRFFLDYLDAFGLLSDFLDHQAVIKFFELETHFSYYPV 160
16751979 161 SGFVAPHQYLSLLQDRYFPIASVMRTLDKDNFSLTPDLIHDLLGHVPWLLHPSFSEFFINMGRLFTKVIEKVQALPSKKQ 240
15836577 161 SGFVAPHQYLSLLQDRYFPIASVMRTLDKDNFSLTPDLIHDLLGHVPWLLHPSFSEFFINMGRLFTKVIEKVQALPSKKQ 240
15618954 161 SGFVAPHQYLSLLQDRYFPIASVMRTLDKDNFSLTPDLIHDLLGHVPWLLHPSFSEFFINMGRLFTKVIEKVQALPSKKQ 240
33242417 161 SGFVAPHQYLSLLQDRYFPIASVMRTLDKDNFSLTPDLIHDLLGHVPWLLHPSFSEFFINMGRLFTKVIEKVQALPSKKQ 240
16751979 241 RIQTLQSNLIAIVRCFWFTVESGLIENHEGRKAYGAVLISSPQELGHAFIDNVRVLPLELDQIIRLPFNTSTPQETLFSI 320
15836577 241 RIQTLQSNLIAIVRCFWFTVESGLIENHEGRKAYGAVLISSPQELGHAFIDNVRVLPLELDQIIRLPFNTSTPQETLFSI 320
15618954 241 RIQTLQSNLIAIVRCFWFTVESGLIENHEGRKAYGAVLISSPQELGHAFIDNVRVLPLELDQIIRLPFNTSTPQETLFSI 320
33242417 241 RIQTLQSNLIAIVRCFWFTVESGLIENHEGRKAYGAVLISSPQELGHAFIDNVRVLPLELDQIIRLPFNTSTPQETLFSI 320
16751979 321 RHFDELVELTSKLEWMLDQGLLESIPLYNQEKYLSGFEVLCQ 362
15836577 321 RHFDELVELTSKLEWMLDQGLLESIPLYNQEKYLSGFEVLCQ 362
15618954 321 RHFDELVELTSKLEWMLDQGLLESIPLYNQEKYLSGFEVLCQ 362
33242417 321 RHFDELVELTSKLEWMLDQGLLESIPLYNQEKYLSGFEVLCQ 362
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap