Conserved Protein Domain Family
PRK14049

?
PRK14049: PRK14049 
ferrioxamine B receptor precursor protein; Provisional
Statistics
?
PSSM-Id: 172541
View PSSM: PRK14049
Aligned: 5 rows
Threshold Bit Score: 1162.74
Threshold Setting Gi: 110632699
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
153011450   1 MRSDCMPLRRTILAGTSLIALAATPIAQDQTTASPTENGAIVLDKIVIDGgSGGVIDADGYVARSSATGAKIDTPFVQTP 80 
150397393   4 RTASLLPLIRAALAGTSALALVATAQAQDVGQESVSDDQSTDLETLVVNG-SGGVITAEGYVATSSATGAKVDTPFLETP 82 
15966022    4 KSALRLPLIRLALAGTSALALVATAQAQEAEQETVSNGDSTALETLVVNG-SGGVITAEGYVGTSSATGAKIDTPFLETP 82 
110632699   4 RS----------FYCSVNLTLLAASAFSWSGSQALAQEAPTLLERLEIEAeSDDILIQDGYVAKQDRIGTKVDTPIAEIP 73 
227822716   4 QTIRLLPLIRATLAGTSALALVATAQAQEAQQETAGNAESTALETLIVNGgSGGVITADGYVGTSSATGAKVDTPFLQTP 83 
153011450  81 QSISSVTQQQLEDRNPQTLLDAIAYTPSARVGGFGFDPRFDSFTVRGFDVTYTGVFRDNLRQPGASSALFKTEPYGLEGV 160
150397393  83 QSISTVTEQQLKDRNPQTLLETLAYTPGTRVGAYGFDPRFDAFFVRGFDVTFTGVFRDNLRQPAAVDSVFKTEPYGLEGV 162
15966022   83 QSISTVTEQQLKDRNPQTLLETLAYTPGTRVGAYGFDPRFDAFFVRGFDVTYSGVFRDNLRQPAAVDSIFKNEPYGLEGV 162
110632699  74 QAISVVTQDQIEDQKPRTLNETLAYTASANPNIFGFDSRYDAFYLRGFPAYYNGLFRDGLRQYNGPSAWFKTEPYGIEGL 153
227822716  84 QSISSVTEQQLKDRNPQTLLDVLAYTPGSRVNAFGFDPRFDSFSVRGFDVTYTGVFRDNLRQPGASSSIFKTEPYGLEGV 163
153011450 161 SILRGPSSALYGASGAGGLFNLISKRPTETPLHEVQVQYGTNNRYQTQFDLSGPVKEGDPLYYRLTGLWRNADTEQPSVP 240
150397393 163 SILRGPSSALYGATGAGGLYNLITKRPTEEMLREVQVQYGNHDRYQGQFDFSGPVNETDPIYYRLTGLLRDADTEQVGLS 242
15966022  163 SILRGPSSALYGATGAGGLYNLITKRPTEDTLREVQVQYGSHDRYQGQFDFSGPVNENDPVYYRLTGLLRDADTEQVGLA 242
110632699 154 TVLKGPASSLYGISGPGGIVNLVTKRPKDERFREVEFLFGGNSRYQTAFDFSGPANEDGSVLYRLTGLGRLSETALPGYP 233
227822716 164 SILRGPSSALYGASGAGGLFNLITKRPTEVPLHELQVQYGTDNRYQGQFDFSGPINETDPVYYRLTGLLRDSDTEQVSVP 243
153011450 241 DDRIYIAPAFTWKPDEDTRLTILSEFSRIKTGGTAAYYYDAVTGKVSDIFAGNTAFNDSVQTQGRVGYEFETRLNDTFVF 320
150397393 243 DDRAYIAPAFTWKPDEDTKLTVLSEYSRTKSGGTATYYNDPLTGEVTDIFAGNPDFNDSIQKQGRIGYEFEHRLNDTFVF 322
15966022  243 DDRAYIAPAFTWKPDEDTKLTVLGEYSRTNSGGTATYYNDPLTGEATDIFAGNPDFNDSVQKQGRVGYEFEHRLNDTFVF 322
110632699 234 DDKLYLAPAITWKPDEGTRLTVLGEVSRAVAGGTAFFYN-PSYGQVSNIYEGDPGWNDFTGVQGRIGYEFEHHFNDVLTL 312
227822716 244 DDRAYIAPAFTWKPDEDTSLTVLGEYSRTKTGGTAAYYNDPLTGEVTDIFAGNPAFNDSVQKQARLGYEFEHRLNETFTF 323
153011450 321 RQNARLASTKIGADWAFAYQANEIDPLLLDSSAGTFEERLTSFTIDNQLEASFDTGNFEHTLLAGVDLTKLQWKGLNGYG 400
150397393 323 RQNARVSTLNIDADWAFAYAPNAADPTLLDSSAGTYDERLTAFVIDNQLEAKFDTGAFEHTLVAGVDYTKLRFRALDGRG 402
15966022  323 RQNARVSTLNIDADWAFAYAPNAADPTLLDSSAGTYDERLTAFVIDNQLEAKFDTGALEHTLLAGVDYTKLRFRALDGRG 402
110632699 313 RQNLRFNAVDADLEYSGHYPADPANPDILARYWGHYKEDMRNFVVDNMAQFTFDTGPVSHVAVAGLDYGWSDYEAFNGVS 392
227822716 324 RQNARISTLNTDADWAFAYAPNDVDPTLLDSSAGTFDERLTAFVIDNQLVAEFDTGALDHTLLAGVDYTKLRFRSLSGTG 403
153011450 401 YTPPLDTRHPSMGRPVAPIDFQTKDVQDQLMAGIYLQDQIRYDAWTITLGGRQDWVSTDTKNTDLATSTSSDFDQSDKAF 480
150397393 403 VSPPLDTKNPTKGRPVEAIDFDTRTVQDQWQLGTYLQDQIRYDAWTLTMGGRYDWVSTDTDTTVLATDSLTTVSQKDKEF 482
15966022  403 VSPPLDTKNPTQGRPVDAIDFNTRTVQDQWQLGTYLQDQIRYDAWTLTVGGRYDWVSTDTDTMDLATDSLTTVSQKDKEF 482
110632699 393 YTSVED---------IAAMPLSFSGSQTMHNVGIYLHDQMQWNALTLFASGRYDWVDSHSTDYLL-----TESDQRDEAF 458
227822716 404 VSPPLDTNNPTQGRPVAAIDFSSRVVQDQWQLGTYLQDQIRYDAWTLTGGARYDWVSTDTDTTDLATDAVSTVSQNDKEF 483
153011450 481 TWRAGLTYETPWGITPYASYSTAFSPNAGV----NRATGNPFEPTESEQQEVGIKYQLPNSNTLITAALFNINQDNGLYY 556
150397393 483 SGRIGLTYQTDFGLAPYISYSTAFMPNAGF----NRATNQPFKPTESEQEEIGIKYLLPNSNTLITAALFNIDQKNGLYL 558
15966022  483 SGRIGLTYQTDFGLAPYISYSTAFAPNAGI----NKETNQPFKPTESEQQEIGVKYLLPNSNTLITAALFNIDQKNGLYL 558
110632699 459 SGRLGVSYRTDWGIIPYANYSTSFSPNLGFvydyGTDQRRVARPTEGRQIEVGVKYEVPDRDMTLGLAYFDIDQTDGVVY 538
227822716 484 SGRIGLTYETDFGLAPYISYSTAFSPNAGI----NRETNQPFKPTESEQQEVGVKYLLPNSNTLITAALFNIDQTNSLYY 559
153011450 557 EvvelDAGPANIQVQRG-KLRSRGLELEASTSLDNGLSLIASYSYMQTSIKDGPDGTVGNEISSVPTHMASAWAHYKLPE 635
150397393 559 E----AAGDTAIQVQRG-KLRSRGFEIEANTSLDNGLSLIVSYAYTDVKIIQGSTGTTGNHVSSAPKHMASIWAHYTLPE 633
15966022  559 E----ASGDTAIQVQRG-KLRSRGFEIEANTSLDNGISLIASYAYTDVKIIQGPSGTIGNYVSSAPQHMASIWAHYTLPE 633
110632699 539 DgtfdAAGN---QIQRQlDLNARGLELEAAASFDNGLGLIASYTYMRMKIERGVEGTEGNELSATPNHILSLWGRYTF-Q 614
227822716 560 EvvdlPTGPENIQVQRG-KVRSRGFELEANTSLDNGLSLVASYTYTDAKILEGPADTIGNYVSSVPRHMASAWAYYTLPE 638
153011450 636 NSFLYGLGVGAGVRFVGSSYGNDENTMKNSSRAFVDAAIDFDFGAIKKDYEGVKLQVNATNLFDTSKPVCSAGFCYRDQG 715
150397393 634 GGPFYGFSLGGGARFVGASYGNDQNTFKNSSRILFDASVGYDFAAIDQKYEGLQLQVNATNLFDRRDAVCTAGYCHRDQG 713
15966022  634 DGPFYGFSLGGGARFVGSSYGNDQNTFKNSSRVLFDASVGYDFAAIDQKYEGLHLQVNATNLFDRREAVCTAGYCHRDQG 713
110632699 615 GGALAGLGLGAGVRYVGESYGDDLNSFKNDDRVFVDASLSYDFGASNPRLEGLMLQVNAKNLFDERKPICTAGNCYWDEG 694
227822716 639 DGPGYGLGFGAGARFLGSSYGNDQNTTRNSSRVLFDAAAHYDFAALDKKYEGLRLQVNATNLFDRREAVCSAGFCYRDRG 718
153011450 716 RTVVGSLKYSW 726
150397393 714 RTVIGSLRYNW 724
15966022  714 RTVIGSLRYNW 724
110632699 695 RSVFGSLRYRF 705
227822716 719 RAVIGSLRYNW 729
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap