Conserved Protein Domain Family
PRK14048

?
PRK14048: PRK14048 
ferrichrome/ferrioxamine B periplasmic transporter; Provisional
Statistics
?
PSSM-Id: 172540
View PSSM: PRK14048
Aligned: 4 rows
Threshold Bit Score: 665.061
Threshold Setting Gi: 153011452
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15966024    4 LLLCRRSLVRVLAFLAIAFSPL--VALAQAQWPMTVTDAVGRQVTIPAPPKAVLLGTGFNLVALSLIHPDPVSLLAGWSG 81 
150397395   4 LLLCRRSLVRAFAFLAIAFSPL--AALAEVQWPMTVTDAVGREVAIPAPPRAVLLGSGFNLIALSLIHPDPIGLLAGWSG 81 
153011452   1 -------MIRLVVCLTVIWLALgkSAVAEVTYPIHVKDALDREVTITAQPKSILLGSGFNLIALSLVHPDPVSVLAGWAG 73 
227822718   1 MPQTSSGVVRSAAMLLIALLAF--TARAQAQWPMTVTDSTGREVTIASRPQAVLLGTGFNLIALSLIHPDPVNLLAGWSG 78 
15966024   82 DMKADNPEIYESYLRKFPKLADVPLIDDGSGPGLSFETILTLKADLAVLANWQADTEAGRRAMEYLESTGVPVIVVDFNN 161
150397395  82 DMKGDNPEIYESFLRKFPALGDVPLIDDGSGPGLSLETILTLKADLAILANWQADTEAGQRAMEYLESIGVPVIVVDFNN 161
153011452  74 DLKGDNPEIYAGFKQRFPEIEKLPII--GDGITVSVEKIVSVKADLVILSDWQMRNDEGVQAIAYLEKMGIPVLVVDFGN 151
227822718  79 DMKGDNPEIYESFRRKFPRLAEVPLIDDGSGPGLSFETILTLKADLALLANWQADTEAGQRAIDYLSGIGVPVVVVDFND 158
15966024  162 EVLKNTPDNMRLLGKVFEREEQAEDFARFYEERLARIRERVAGSSEPGPKVLMEAFPAPDRCCWAYGVGGLGEFIAITGS 241
150397395 162 EALKNTPDNMRLLGKVFEREEQAEDFARFYEERLARIRERVAGHPEPGPRVLMEAFPAADRCCWAYGTGGLGEFIAVTGS 241
153011452 152 HALENTSKNMRLLGKVLNREEQANAFADFYDERIARIRDRVVK-SDAGPTVLLEAFPNADQCCYAYGRTSMGEFITLTGS 230
227822718 159 DVLKRTPDTMRLLGKIFEREEKAEEFARFYEERLARIRDRVAKHPEPGPTVLMEAFPGADRCCWAYGIGGLGEFISLTGS 238
15966024  242 RNIAEGALPRPGGMMNAEAVMAENPDVYIATSSPGGKYSGFSIGPGVTAEEAETTLTESVDKPVMASIAAVRNGRVHGLW 321
150397395 242 RNVAEGALPRPGGMMNAEAVMAENPDVYIATSSPGGKYSGFSIGPGVGAEEAETTLAAVVDKPLMASIAAVRDRRVHGIW 321
153011452 231 RNIAADG-PAQGGVISSEFIVAADPQVYIATSSPGGKYSGFSVGPGVSEQEARDTLSNALKNPFRAGLKAVNDKRVHGLW 309
227822718 239 RNIAEGKLPRPGGMMNAEAIMAENPEVYIATSSPGGKYSGFSIGPGVSGDEAERTLAKVAATPVMESIGAVRNGRVHGIW 318
15966024  322 NFFNAVPLNIVAAEAFASWLRPDLFPDVDPAATLAEINRRFAAVPFEGSYWISLKK 377
150397395 322 NFFNAVPLNIVAAEAFASWLRPDLFPDINPAATLSEINRRFAAVPFEGAYWVSLKK 377
153011452 310 NFFNAVPLNVLAAEAFAVWLRPELFADISPEATLAEINQRFAAVPFEGSYWISLKP 365
227822718 319 NFFNAIPLNIVAAEAFAAWLRPELFADVDPAKTLAEINERFAAVPFDGAYWISLRK 374
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap