Conserved Protein Domain Family
PRK14045

?
PRK14045: PRK14045 
1-aminocyclopropane-1-carboxylate deaminase; Provisional
Statistics
?
PSSM-Id: 172537
View PSSM: PRK14045
Aligned: 3 rows
Threshold Bit Score: 593.789
Threshold Setting Gi: 161350013
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
161484715   1 MHPKVQSLLSKFPRVELIPWETPIQYLPNISKLVGADIYVKRDDLTGLGIGGNKIRKLEYLLGDAIIRKADVIITVGAVH 80 
161350013   1 MHPKIFALLAKFPRVELIPWETPIQYLPNISREIGADVYIKRDDLTGLGIGGNKIRKLEYLLGDALSKGADVVITVGAVH 80 
14520280    1 MHPKVDALLSRFPRITLIPWETPIQYLPRISRELGVDVYVKRDDLTGLGIGGNKIRKLEFLLGDALSRGCDTVITIGAVH 80 
161484715  81 SNHAFVTGLAAKKLGFDVVLVLRGKEELRGNYLLDKIMGIETRVYEAKDSFELMKYAEEVAKELEEKGRKPYIIPVGGAS 160
161350013  81 SNHAFVTGLAAKKLGLDAILVLRGKEELKGNYLLDKIMGIETRVYDAKDSFELMKYAEEIAEELKREGRKPYVIPPGGAS 160
14520280   81 SNHAFVTALAAKKLGLGAVLILRGEEVLKGNYLLDKLMGIETRIYEADNSWELMKVAEEVAEELKGEGKKPYIIPPGGAS 160
161484715 161 PVGTLGYVRASGEIAEQGNrigVNFDSIVVATGSGGTLAGLSVGLAILRKETRAIGMAVGKFGETMVNKVEELAKATGEF 240
161350013 161 PIGTLGYVRAVGEIATQSE---VKFDSIVVAAGSGGTLAGLSLGLSILNEDIRPVGIAVGRFGEVMTSKLDNLIKEAAEL 237
14520280  161 PVGTLGYIRGVGELYTQVKklgLRIDTVVDAVGSGGTYAGLLLGSAIVNAEWSVVGIDVSSATEKAKERVKNLVEKTKEL 240
161484715 241 IGVKNLKlKIELYDYSFGEYGKITREVAETIRLVGTKEGVILDPVYTGKAFYGLLDLAKKGELGEKILFIHTGGISGTFH 320
161350013 238 LGVKVEV-RPELYDYSFGEYGKITGEVAQIIRKVGTREGIILDPVYTGKAFYGLVDLARKGELGEKILFIHTGGISGTFH 316
14520280  241 LGINVKVqEPRIYDYGFGAYGKIVKEVAKLIKSVGTMEGLLLDPVYTGKAFYGLMDLAKKGDLGESVLFIHTGGLPGIFH 320
161484715 321 YGDKILSFL 329
161350013 317 YGDKLLSLL 325
14520280  321 YGEEMLELL 329
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap