Conserved Protein Domain Family
PRK14042

?
PRK14042: PRK14042 
pyruvate carboxylase subunit B; Provisional
Statistics
?
PSSM-Id: 172536
View PSSM: PRK14042
Aligned: 5 rows
Threshold Bit Score: 1238.06
Threshold Setting Gi: 54293458
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
52840711    7 MSKTFITDVTLRDAHQCLIATRMRTEDMLPICNKMDDVGFWAMEVWGGATFDACLRFLKEDPWSRLRQLRQMLPNTQLSM 86 
54293458    1 MSKTFITDVTLRDAHQCLIATRMRTEDMLPICNKMDDVGFWAMEVWGGATFDACLRFLKEDPWSRLRQLRQALPNTQLSM 80 
54296500    1 MSKTFITDVTLRDAHQCLIATRMRTEDMLPICNKMDDVGFWAMEVWGGATFDACLRFLKEDPWSRLRQLRQVLPNTQLSM 80 
148360918   1 MSKTFITDVTLRDAHQCLIATRMRTEDMLPICNKMDDVGFWAMEVWGGATFDACLRFLKEDPWSRLRQLRQALPNTQLSM 80 
296106016   1 MSKTFITDVTLRDAHQCLIATRMRTEDMLPICNKMDDVGFWAMEVWGGATFDACLRFLKEDPWSRLRQLRQALPNTQLSM 80 
52840711   87 LLRGQNLLGYRNYADDVVRAFVKLAVNNGVDVFRVFDALNDARNLKVAIDAIKSHKKHAQGAICYTTSPVHTLDNFLELG 166
54293458   81 LLRGQNLLGYRNYADDVVRAFVKLAVNNGVDVFRVFDALNDARNLKVAIDAIKSHKKHAQGAICYTTSPVHTLDNFLELG 160
54296500   81 LLRGQNLLGYRNYADDVVRAFVKLAVNNGVDVFRVFDALNDARNLKVAIDAIKSHKKHAQGAICYTTSPVHTLDNFLELG 160
148360918  81 LLRGQNLLGYRNYADDVVRAFVKLAVNNGVDVFRVFDALNDARNLKVAIDAIKSHKKHAQGAICYTTSPVHTLDNFLELG 160
296106016  81 LLRGQNLLGYRNYADDVVRAFVKLAVNNGVDVFRVFDALNDARNLKVAIDAIKSHKKHAQGAICYTTSPVHTLDNFLELG 160
52840711  167 KKLAEMGCDSIAIKDMAGLLTPTVTVELYAGLKQATGLPVHLHSHSTSGLASICHYEAVLAGCNHIDTAISSFSGGASHP 246
54293458  161 KKLAEMGCDSIAIKDMAGLLTPAVTVELYAGLKQATGLPVHLHSHSTSGLASICHYEAVLSGCNHIDTAISSFSGGASHP 240
54296500  161 KKLAEMGCDSIAIKDMAGLLTPTVTVELYAGLKQATGLPVHLHSHSTSGLASICHYEAVLAGCNHIDTAISSFSGGASHP 240
148360918 161 KKLAEMGCDSIAIKDMAGLLTPTVTVELYAGLKQATGLPVHLHSHSTSGLASICHYEAVLAGCNHIDTAISSFSGGASHP 240
296106016 161 KKLAEMGCDSIAIKDMAGLLTPTVTVELYAGLKQATGLPVHLHSHSTSGLASICHYEAVLAGCNHIDTAISSFSGGASHP 240
52840711  247 PTEALVAALTDTPYDTELDLNILLEIDDYFKAVRKKYSQFESEAQNIDPRVQLYQVPGGMISNLYNQLREQNALDKMDAV 326
54293458  241 PTEALVAALTDTPYDTELDLNILLEIDDYFKAVRKKYSQFESEAQNIDPRVQLYQVPGGMISNLYNQLREQNALDKMDAV 320
54296500  241 PTEALVAALTDTPYDTELDLNILLEIDDYFKAVRKKYSQFESEAQNIDPRVQLYQVPGGMISNLYNQLKEQNALDKMDAV 320
148360918 241 PTEALVAALTDTPYDTELDLNILLEIDDYFKAVRKKYSQFESEAQNIDPRVQLYQVPGGMISNLYNQLKEQNALDKMDAV 320
296106016 241 PTEALVAALTDTPYDTELDLNILLEIDDYFKAVRKKYSQFESEAQNIDPRVQLYQVPGGMISNLYNQLKEQNALDKMDAV 320
52840711  327 HKEIPRVRKDLGYPPLVTPTSQVVGTQAVINVLTGERYKTITNEVKLYCQGKYGTPPGKISSALRKKAIGRTEVIEVRPG 406
54293458  321 HKEIPRVRKDLGYPPLVTPTSQIVGTQAVINVLTGERYKTITNEVKLYCQGKYGTPPGKISSALRKKAIGRTEVIEVRPG 400
54296500  321 HKEIPRVRKDLGYPPLVTPTSQVVGTQAVINVLTGERYKTITNEVKLYCQGKYGTPPGKISSALRKKAIGRTEVIEVRPG 400
148360918 321 HKEIPRVRKDLGYPPLVTPTSQVVGTQAVINVLTGERYKTITNEVKLYCQGKYGTPPGKISSALRKKAIGRTEVIEVRPG 400
296106016 321 HKEIPRVRKDLGYPPLVTPTSQVVGTQAVINVLTGERYKTITNEVKLYCQGKYGTPPGKISSALRKKAIGRTEVIEVRPG 400
52840711  407 DLLPNELDQLQNEISDLALSDEDVLLYAMFPEIGRQFLEQRKNNQLIPEPLLTQSSAPDNSVMSEFDIILHGESYHVKVA 486
54293458  401 DLLPNELDQLQNEISDLALSDEDVLLYAMFPEIGRQFLEQRKNNQLIPEPLLTQSSAPDNSVMSEFDIILHGESYHVKVA 480
54296500  401 DLLPNELDQLQNEISDLALSDEDVLLYAMFPEIGRQFLEQRKNNQLIPEPLLTQSSAPDNSVMSEFDIILHGESYHVKVA 480
148360918 401 DLLPNELDQLQNEISDLALSDEDVLLYAMFPEIGRQFLEQRKNNQLIPEPLLTQSSAPDNSVMSEFDIILHGENYHVKVA 480
296106016 401 DLLPNELDQLQNEISDLALSDEDVLLYAMFPEIGRQFLEQRKNNQLIPEPLLTQSSAPDNSVMSEFDIILHGENYHVKVA 480
52840711  487 GYGMIEHGQQSCFLWVDGVPEEVVVQHSELHDKIERSSVNNKIGPGDITVAIPGSIIAIHVSVGDEVKAGQAVLVIEAMK 566
54293458  481 GYGMIEHGQQSCFLWVDGVPEEVVVQHSELHDKIERSSVNNKIGPGDITVAIPGSIIAIHVSSGDEVKAGQAVLVIEAMK 560
54296500  481 GYGMIEHGQQSCFLWVDGVPEEVVVQHSELHDKIERSSVNNKIGPGDITVAIPGSIIAIHVSAGDEVKAGQTVLVIEAMK 560
148360918 481 GYGMIEHGQQSCFLWVDGVPEEVVVQHSELHDKIERSSVNNKIGPGDITVAIPGSIIAIHVSAGDEVKAGQAVLVIEAMK 560
296106016 481 GYGMIEHGQQSCFLWVDGVPEEVVVQHSELHDKIERSSVNNKIGPGDITVAIPGSIIAIHVSAGDEVKAGQAVLVIEAMK 560
52840711  567 METEIKAPANGVVAEILCQKGDKVTPGQVLIRVEVS 602
54293458  561 METEIKAPANGVVAEILCQKGDKVTPGQVLIRVEVS 596
54296500  561 METEIKAPANGVVAEILCQKGDKVTPGQVLIRVEVS 596
148360918 561 METEIKAPANGVVAEILCQKGDKVTPGQVLIRVEVS 596
296106016 561 METEIKAPANGVVAEILCQKGDKVTPGQVLIRVEVS 596
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap