Conserved Protein Domain Family
PRK14038

?
PRK14038: PRK14038 
ADP-specific glucokinase
Statistics
?
PSSM-Id: 172532
View PSSM: PRK14038
Aligned: 7 rows
Threshold Bit Score: 745.06
Threshold Setting Gi: 242398244
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
14590485    5 TNWESLYEKALDKVEASIRKVRGVLLAYNTNIDAIKYLKREDLEKRIEKVGKEEVLRYSEELPKEIETIPQLLGSILWSI 84 
14521653    1 MSWDEMYRDAYERVLNSIGKIKGVMLAYNTNIDAIKYLKREDLERRIEEAGKDEVLRYSDELPKKINTIQQLLGSILWSV 80 
18976684    2 PTWEELYKNAIEKAIKSVPKVKGVLLGYNTNIDAIKYLDSKDLEERIIKAGKEEVIKYSEELPDKINTVSQLLGSILWSI 81 
57641045    1 MNWDGLYASAFERIRDNIGKVGNVLLAYNTNIDAIKYLEREDLERRIGAAGREEVLPYSEKLPKRIESVPQLLGSILWSI 80 
212223392   1 MMWDALYSSAFQRVKDKIGKVGSVLLAYNTNIDAIKYLDSEDLEGRVEKVGKEEVFCFSEELPGRITKIHHLLGGILWSI 80 
240102875   1 -MWDRLYASAFERVRANMGKVNGVLLAYNTNIDAINYLERRDLEERIERAGMEEVLRYSEELPERITSVPQLLGSILWSI 79 
242398244  10 KLWKNLYMNAFENAVNAIPNVEGVLLAYNTNIDVIKYLNKDDLERRINQIGKERVFEVIKAPTERISSLEHLFGGILRSI 89 
14590485   85 KRGKAAELLVVSREVREYMRKWGWDELRMGGQVGIMANLLGGVYGIPVIAHVPQLSELQASLFLDGPIYVPTFERGeLRL 164
14521653   81 KRGKAAELLVEDREVRNYMRQWGWDELRMGGQVGIMANLLGGVYGIPVIAHVPQISKLQASLFLDGPIYVPTFEEG-LKL 159
18976684   82 RRGKAAELFVESCPVRFYMKRWGWNELRMGGQAGIMANLLGGVYGVPVIVHVPQLSRLQANLFLDGPIYVPTLENGeVKL 161
57641045   81 RRGKAAELFVESCSTRFYMRRWGWDELRMGGQVGIMANLLGGVYGVPVIAHVPQLSRLQAELFKDGPIYVPKVEGGkLKL 160
212223392  81 RRGKAAELFVESCTVRLYMKNWGWDELRMGGQVGIMANLLGGVYGVPVIAHVPQISKLQANLFKDGPIYVPKLEDGkLKL 160
240102875  80 RRGKAAELFVESCTVRFYMRQWGWDELRMGGQVGIMANLLGGVYGVPVIAHVPQLSHLQAGLFKDGPIYVPKVENDeLRL 159
242398244  90 KLGKAIEWFVENEEIRRYLREWGWDELRIGGQAGIMANLIGGVYRIPTIVHVPQNPKLQADLFVDGPIYVPIFEGKeLKL 169
14590485  165 IHPREFRKGEEDCIHYIYEFPRNFKVLDFEAPRENRFIGAADDYNPILYVREEWIERFEEIAKRSELAIISGLHPLTQ-- 242
14521653  160 VHPRNFEGNEEDCIHYIYEFPRGFKVLNFTAPRENRFIGAADDYNPRLYIRKEWVERFEEIAERAELAIVSGLHSLTE-- 237
18976684  162 IHPKEFSGDEENCIHYIYEFPRGFRVFEFEAPRENRFIGSADDYNTTLFIREEFRESFSEVIKNVQLAILSGLQALTK-- 239
57641045  161 VHPKEFKADEENCIHYIYEFPRGFRVFDFEAPRENRFIGSADDYNTNVVIRPEFEEHFGEIAEKTELAIISGLQALTE-- 238
212223392 161 LHPREFAGDEENLIHYIYEFPRGFRVFDFEAPRENRFIGSADDYNPNVYIRPEFREAFEEIAGKAELVIISGLQALTK-- 238
240102875 160 VHPRDFGGDEESCIHYIYEFPRGFRVFNFEAPRENRFIGAADDYNTNLYIRPEFRERFDEIVEKAELAIISGLQALTK-- 237
242398244 170 VHPKEAVKEENELIHYIYEFPRGFQVFDIQAPRENRFIANADDYNARVYMRKEFKESFEKIAKGVELAIISGLQVLKEyy 249
14590485  243 ---ENHGKPIKLVREHLKILNDLGIRAHLEFAFTPDEVVRLEIVKLLKHFYSVGLNEVELASVVSVMGEKELAERIISKD 319
14521653  238 ---ETYREPIKVVREHLKVLKDLNIKTHLEFAFTADEKVRREILGLLSLVYSVGLNEVELASVLEIMNERELADRILAKD 314
18976684  240 ---ENYKEPFEIVKSNLEVLNEREIPVHLEFAFTPDEKVREEILNVLGMFYSVGLNEVELASIMEILGEKKLAKELLAHD 316
57641045  239 ---GNYREPFETIKEHLDVLEGKGIPAHLEFAFTPDETVRKEILGVLGKFWSVGLNEVELASIMDVMGEKTLAEKLLAHD 315
212223392 239 ---ENYKEPFEELERHLEVLDERGIPVHLEFAFTPDETVRRRLVEILGKFTSVGLNEVELASIMEVLGEKAIAEKLLAND 315
240102875 238 ---DNYRKPFETVREHLKVLNERGIPAHLEFAFTPDETVRKAILDLLPAFWSVGLNEVELASIMEVMGEKRLAEKLLASD 314
242398244 250 sdgTTYRDVLDRVESHLNILNRYGVRSHFEFAYTPNRLVREELIGILSKFTSVGLNEVELASIVEIIGDETLAKEVLEG- 328
14590485  320 PADPIAVIEGLLKLIKEtGVKRIHFHTYGYYLALTREKGEHVRDALLFSALAAATKAMKGNIEKLSDIREGLAVPIGEQG 399
14521653  315 PADPVAVIEGLMKLIEE-GVERIHFHTYGYYLAITKYRGEHVRDALLFSALAAATKAMLGNIEKLDDLRKGLEVPIGRQG 393
18976684  317 PVDPIAVTEAMLKLAKKtGVKRIHFHTYGYYLALTEYKGEHVRDALLFAALAAAAKAMKGNITSLEEIREATSVPVNEKA 396
57641045  316 PVDPIVVTKAMLKLAEKtGVRRIHFHTYGYYLALTDYRGEFVRDALLFAALAAAAKAKLGDVRNIDDVVKAMDVPVNEKA 395
212223392 316 PVDPIAVTEAMLKLAEKtGVERIHFHTYGYYLALTAYDGTHVRDALLFAALAAAARAKLGDVRDIDDVVKAMDVPVNEKV 395
240102875 315 PVDPIAVTEAMLKLAEKtGVKRIHFHTYGYYLALTDYRGEFVRDALLFAALAAAAKAKLGDVPSIGEVVRAMDVPVNERA 394
242398244 329 --HVFPIIDAINLLMDEtGIDRIHLHTYGYYLALTKYRSEEVRDALLFASLAAAAKAMKGNIEKIDHVKDALSVPTNERA 406
14590485  400 LEVEKILEKEF-SLRDGIGSIEDYQLTFIPTKVVKKPKSTVGIGDTISSSAFVSEFSLH 457
14521653  394 LEVYEVVKREF-NVEKGIGEVGDYQIAFVPTKIVEKPKSTVGIGDTISSSAFVSEFSLS 451
18976684  397 TQVEEKLRAEY-GIKEGIGEVEGYQIAFIPTKIVAKPKSTVGIGDTISSSAFIGEFSFT 454
57641045  396 KGVEEALTKEY-GMENGIAEVNGYQLAFIPTKIVAKPKSTVGIGDTISSSAFVGEFALR 453
212223392 396 RAVEGALVREY-GTEDGIAKVDDYQLAFVPTKIVTKPKSTVGIGDTISSSAFIGEFALR 453
240102875 395 KPVEEALAREY-GMRNGIAEVNGYQLAFIPTKIVAKPKSTVGIGDTISSSAFIGEFALR 452
242398244 407 IVFEEELEKEFtEFENGLIDMVDRQLAFVPTKIVTSPKSTVGIGDTISSSAFVSEFAMR 465
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap