Conserved Protein Domain Family
PRK14029

?
PRK14029: PRK14029 
pyruvate/ketoisovalerate ferredoxin oxidoreductase subunit gamma; Provisional
Statistics
?
PSSM-Id: 172523
Aligned: 7 rows
Threshold Bit Score: 311.571
Threshold Setting Gi: 14590560
Created: 9-Dec-2010
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
14521567    1 MIEIRFHGRGGQGAVTAANILAEAAFIEGKYVQAFPFFGVERRGAPVTAFTRIDEKPIRIKTQIYEPDVVVVLDPSLLET 80 
14590560    1 MIEIRFHGRGGQGAVTAANILAEAAFLEGKYVQAFPFFGVERRGAPVTAFTRIDEKPIRIKTQIYEPDIVVVLDPSLLET 80 
18977343    1 MIEVRFHGRGGQGAVTAANILAEAAFLEGKYVQAFPFFGVERRGAPVTAFTRIDNKPIRIKTQIYEPDVVVVLDPSLLDA 80 
57641913    1 MIEIRFHGRGGQGAVTAANILASAAFKEGKYVQAFPFFGVERRGAPVTAFTRIDDKPIRIKTQIYEPDVVVVLDPSLLDT 80 
212224627   2 MIEIRFHGRGGQGAVTAANILASAAFLEGKYVQAFPFFGVERRGAPVTAFTRIDEKPIRIKTQIYEPDIVVVLDPSLLDT 81 
240102325   1 MIEIRFHGRGGQGAVTAANILASAAFKEGKYVQAFPFFGVERRGAPVTAFTRIDDKPIRIKTQIYEPDIVVVLDPSLLET 80 
242399360   2 MIEIRFHGRGGQGAVTAANILAEGAFLEGKYVQAFPFFGVERRGAPVTAFTRIDEKPIRIKTQIYEPDVVVVLDPSLLDT 81 
14590560    1 MIEIRFHGRGGQGAVTAANILAEAAFLEGKYVQAFPFFGVERRGAPVTAFTRIDEKPIRIKTQIYEPDIVVVLDPSLLET 80 
18977343    1 MIEVRFHGRGGQGAVTAANILAEAAFLEGKYVQAFPFFGVERRGAPVTAFTRIDNKPIRIKTQIYEPDVVVVLDPSLLDA 80 
57641913    1 MIEIRFHGRGGQGAVTAANILASAAFKEGKYVQAFPFFGVERRGAPVTAFTRIDDKPIRIKTQIYEPDVVVVLDPSLLDT 80 
212224627   2 MIEIRFHGRGGQGAVTAANILASAAFLEGKYVQAFPFFGVERRGAPVTAFTRIDEKPIRIKTQIYEPDIVVVLDPSLLDT 81 
240102325   1 MIEIRFHGRGGQGAVTAANILASAAFKEGKYVQAFPFFGVERRGAPVTAFTRIDDKPIRIKTQIYEPDIVVVLDPSLLET 80 
242399360   2 MIEIRFHGRGGQGAVTAANILAEGAFLEGKYVQAFPFFGVERRGAPVTAFTRIDEKPIRIKTQIYEPDVVVVLDPSLLDT 81 
14521567   81 VDVTAGLKEDGIVIVNTEKSKEEVLEKLKRKPKKLALVDATTIALETLGLPITNTAILGAVAKATGLVKIESVETAIKDT 160
14590560   81 VDVTAGLKEEGIVIINTEKSKDEILEKLKKKPKKLALVDATTIALETLGLPITNTAILGAVAKATGLVNIESVEKAIKDT 160
18977343   81 VDVTAGLKDEGIVIVNTEKSKEEVLEKLKKKPKKLAIVDATTIALEILGLPITNTAILGAVAKATGLVKIESIEEAIKDT 160
57641913   81 VDVTAGLKDGGIVIVNTEKSKEEVLEKLKKKPGKLALVDATGIALEILGLPITNTAILGAVAKATGLVKLESVQEAIKET 160
212224627  82 VDVTAGLKDGGIVIVNTEKSKEEVLEKLKKKPAKLALVDATTIALEILGLPITNTAILGAVAKATGVVSLEHVQKAIQDV 161
240102325  81 VDVTAGLKDGGIVIINTEKSKEEVLEKLKKKPGKLALVDATSIALEVLGLPITNTAILGAVAKATGLVKLESVQEAIKET 160
242399360  82 VDVTAGLKEGGLVIVNTEKTKEEVLEKLKKKPAKLALVDATTIALEILGLPITNTSILGAVAKATGIVKIESVEEAIKEA 161
14590560   81 VDVTAGLKEEGIVIINTEKSKDEILEKLKKKPKKLALVDATTIALETLGLPITNTAILGAVAKATGLVNIESVEKAIKDT 160
18977343   81 VDVTAGLKDEGIVIVNTEKSKEEVLEKLKKKPKKLAIVDATTIALEILGLPITNTAILGAVAKATGLVKIESIEEAIKDT 160
57641913   81 VDVTAGLKDGGIVIVNTEKSKEEVLEKLKKKPGKLALVDATGIALEILGLPITNTAILGAVAKATGLVKLESVQEAIKET 160
212224627  82 VDVTAGLKDGGIVIVNTEKSKEEVLEKLKKKPAKLALVDATTIALEILGLPITNTAILGAVAKATGVVSLEHVQKAIQDV 161
240102325  81 VDVTAGLKDGGIVIINTEKSKEEVLEKLKKKPGKLALVDATSIALEVLGLPITNTAILGAVAKATGLVKLESVQEAIKET 160
242399360  82 VDVTAGLKEGGLVIVNTEKTKEEVLEKLKKKPAKLALVDATTIALEILGLPITNTSILGAVAKATGIVKIESVEEAIKEA 161
14521567  161 FSGELGEKNAKAAREAFEKTQIFEV 185
14590560  161 FSGELGEKNAKAAREAFEKTEIFEV 185
18977343  161 FSGELGEKNARAAREAYEKTEVFEL 185
57641913  161 FSGALGEKNAKAAEEAFNKTVVYEL 185
212224627 162 FSGALGEKNAKAAEEAFNKTVIYEL 186
240102325 161 FSGALGEKNAKAAEEAFNKTTVYEL 185
242399360 162 FSGELGEKNAKAAREAFEKTVVYEL 186
14590560  161 FSGELGEKNAKAAREAFEKTEIFEV 185
18977343  161 FSGELGEKNARAAREAYEKTEVFEL 185
57641913  161 FSGALGEKNAKAAEEAFNKTVVYEL 185
212224627 162 FSGALGEKNAKAAEEAFNKTVIYEL 186
240102325 161 FSGALGEKNAKAAEEAFNKTTVYEL 185
242399360 162 FSGELGEKNAKAAREAFEKTVVYEL 186
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap