Conserved Protein Domain Family
PRK14028

?
PRK14028: PRK14028 
pyruvate ferredoxin oxidoreductase subunit gamma/delta; Provisional
Statistics
?
PSSM-Id: 172522
View PSSM: PRK14028
Aligned: 4 rows
Threshold Bit Score: 650.522
Threshold Setting Gi: 171186242
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
126460655   1 MRVETVWLGRGGQGIVTATYIIANAAVIDGLYAIANPEFGAERRGAPVKAFLTVSKDPIEDQEPVKTPDVAVIFDDKLID 80 
119871838   1 MRIETLWLGRGGQGIVTATYIIANAAVMDGFYAIANPEFGAERRGAPVKAFLTIDKNPIEDLEPIKTPDAVIIFDDKLID 80 
145592473   1 MRIETVWVGRGGQGIVTATYIIANASIIDGFHAIANPEFGAERRGAPVKAFLTISKEPIEDQEPVKTPHVAVVFDDKLLG 80 
171186242   1 MRVETIWLGRGGQGIVTATYIVANAAVIDGFYAIANPEFGAERRGAPVKAFLTIDKNPIEDQEPIKTPDVAIIFDDKLID 80 
126460655  81 PMRFAIDAVKPGGYIILNTGKRPEEARKLVGRDDVYLVVLDAIDIARRHLKLDIPNGPLAGAFAKVMGFPSLESIRQAFE 160
119871838  81 SMRFAIDAVKPGGYVIVNSAKQPEEVRKIVGRNDVYIVVVDAVGIAMKHVGLPVPNGPLAGAFSKVMGFPRLESIKTAFE 160
145592473  81 AMQFVIDAVKPGGYVILNTGKSPQDAAALVGRDDVNIVVIDAIAIARKHLKLDVPNGPLAGAFSKVMGFPSLQSIREAFE 160
171186242  81 PMRFAIDAVKPGGYVIVNSAKQPEEVRKLVGRNDVYVVVLDAVGIAMKHVGLPVPNGPLAGAFSKVMGFPRLESIKTAFE 160
126460655 161 TQLGKAVEENFAATKEAYETAVVIPPERVDKSAKPKGIISTTSAFLTGPYDIVGWQEVNKAGAVFPGTSFFYTTGGWRID 240
119871838 161 NQLGKAVEENFAATKEAYEVAVVLKPEKVDTSAKPKGVISTTSAFLTGPYELVGWQQVNKGGAVGPGSSLQYLTGGWRIE 240
145592473 161 TQLGKAVEENFAAVKEAYEVAAVIPAKKVDASAKPKGIISTTSAFLTGPYEVVGWREVNKAGAVFPGSSFPYATGGWRID 240
171186242 161 NQLGKAVEENFAATKEAYEVAVVLKPEKVDASAKPKGVISTTSAFLTGPYELVGWQQVNKGGAVGPGSSLPYLTGGWRIE 240
126460655 241 KPVIDHSKCIMCRKCWLYCPDDAIIEAWREVEGPRGRKFRMKFIDFDYAFCKGCGVCAEVCPTGAIQMVREI 312
119871838 241 KPIIDHSKCIMCRKCWLYCPDDAIIEAWREAPGPRGRVFRTKVIDFDYQYCKGCGICAEVCPTGAIQMVREI 312
145592473 241 KPVIDHSKCIMCRKCWLYCPDDAIIEAWVEREGPRGRKFRMKMIDFDYQYCKGCGVCAEVCPTGAIQMVREI 312
171186242 241 KPIIDHSKCIMCRKCWLYCPDDAIIEAWREAPGPRGRVFRTKAIDFDYQYCKGCGVCAEVCPTGAIQMVREI 312
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap