Conserved Protein Domain Family
PRK14027

?
PRK14027: PRK14027 
quinate/shikimate dehydrogenase (NAD+)
Statistics
?
PSSM-Id: 172521
View PSSM: PRK14027
Aligned: 4 rows
Threshold Bit Score: 512.276
Threshold Setting Gi: 25026999
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
62389324    1 MNDSILLGLIGQGLDLSRTPAMHEAEGLAQGRATVYRRIDTLGSRASGQDLKTLLDAALYLGFNGLNITHPYKQAVLPLL 80 
19551669    1 MNDSILLGLIGQGLDLSRTPAMHEAEGLAQGRATVYRRIDTLGSRASGQDLKTLLDAALYLGFNGLNITHPYKQAVLPLL 80 
25026999    2 NHDSILLGLIGEDISLSRTPAMHEAEGLAQGAATVYRRIDTLTDRARGRSLQELLDAARSTGFNGLNITHPYKQAVLPLL 81 
145294543   1 MNDSILLGLIGQGLDLSRTPAMHEAEGLAQGRATVYRRIDTLGSRASGQDLKTLLDAALYLGFNGLNITHPYKQAVLPLL 80 
62389324   81 DEVSEQATQLGAVNTVVIDATGHTTGHNTDVSGFGRGMEEGLPNAKLDSVVQVGAGGVGNAVAYALVTHGVQKLQVADLD 160
19551669   81 DEVSEQATQLGAVNTVVIDATGHTTGHNTDVSGFGRGMEEGLPNAKLDSVVQVGAGGVGNAVAYALVTHGVQKLQVADLD 160
25026999   82 DEVSEQAAQLGAVNTVVIGEDGRTSGHNTDVTGFARGLEEGLPDATMTTVVQVGAGGVGNAVAYSLVTHGVEQLQVADLD 161
145294543  81 DEVSEQATQLGAVNTVVIDANGHTTGHNTDVSGFGRGMEEGLPNAKLDSVVQVGAGGVGNAVAYALVTHGVQKLQVADLD 160
62389324  161 TSRAQALADVINNAVGREAVVGVDARGIEDVIAAADGVVNATPMGMPAHPGTAFDVSCLTKDHWVGDVVYMPIETELLKA 240
19551669  161 TSRAQALADVINNAVGREAVVGVDARGIEDVIAAADGVVNATPMGMPAHPGTAFDVSCLTKDHWVGDVVYMPIETELLKA 240
25026999  162 PARAQALADAINSAIGREAVHGIDARGVEEAIAAADGVVNATPMGMLAHPGTAFDTSCLTPHHWVGDVVYMPIETQLLKD 241
145294543 161 TSRAQALADVINNAVGREAVVGVDARGIEDVIAAADGVVNATPMGMPAHPGTAFDVSCLTKDHWVGDVVYMPIETELLKA 240
62389324  241 ARALGCETLDGTRMAIHQAVDAFRLFTGLEPDVSRMRETFLSL 283
19551669  241 ARALGCETLDGTRMAIHQAVDAFRLFTGLEPDVSRMRETFLSL 283
25026999  242 ARALGCRTLDGTRMAIHQAVDAFRLFTGLEPDVERMRATFLSL 284
145294543 241 ARALGCETLDGTRMAIHQAVDAFRLFTGLEPDVSRMRETFLSL 283
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap