Conserved Protein Domain Family
hisH

?
PRK14004: hisH 
imidazole glycerol phosphate synthase subunit HisH; Provisional
Statistics
?
PSSM-Id: 172505
View PSSM: PRK14004
Aligned: 6 rows
Threshold Bit Score: 374.24
Threshold Setting Gi: 183220280
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
24212825    1 MIAILDYGMGNIHSCLKAVSLYTKDFVFTKDHSTIENSKALILPGDGHFDKAMENLNSTGLRKTIDKHVTSGKPLFGICI 80 
45656023    1 MIAILDYGMGNIHSCLKAVSLYTKDFVFTKDHSTIENSKALILPGDGHFDKAMENLNSTGLRKTIDKHVTSGKPLFGICI 80 
116329887   1 MIAILDYGMGNIHSCIKAVSLYTKDFVYTNNKTTIENSKALILPGDGHFDRAMENLNSTGLRETIDKHVNSGKPLFGICI 80 
116326881   1 MIAILDYGMGNIHSCIKAVSLYTKDFVYTNNKTTIENSKALILPGDGHFDRAMENLNSTGLRETIDKHVNSGKPLFGICI 80 
183220280   1 MIAVLDFGMGNIHSLLKAVSLYTNDFVFTSDPEKVKLADKIILPGDGHFDKAMQNLNELGFTSLIKDHIERKKYLFGICI 80 
189910398   1 MIAVLDFGMGNIHSLLKAVSLYTNDFVFTSDPEKVKLADKIILPGDGHFDKAMQNLNELGFTSLIKDHIERKKYLFGICI 80 
24212825   81 GFQILFESSEEIAQGSKKEQIEGLGYIKGKIKKFHGK-DFKVPHIGWNRLQIRRKDKSVLLKGIGDQSFFYFIHSYRPTD 159
45656023   81 GFQILFESSEEIAQGSKKEQIEGLGYIKGKIKKFHGK-DFKVPHIGWNRLQIRRKDKSVLLKGIGDQSFFYFIHSYRPTD 159
116329887  81 GFQILFESSEETTQGTKKEQIEGLGYIKGKVKKFQGK-DFKVPHIGWNRLQIRRKDKSILLKGIGDQSFFYFIHSYRPTS 159
116326881  81 GFQILFESSEETTQGTKKEQIEGLGYIKGKVKKFQGK-DFKVPHIGWNRLQIRRKDKSILLKGIGDQSFFYFIHSYRPTS 159
183220280  81 GYQVLFEDSDETNK--PGSTISGLGLIRGKIRKFEGKaNLKVPHMGWNKLFDIKQKNSKLLKGIPNESFMYFIHSYRPVG 158
189910398  81 GYQVLFEDSDETNK--PGSTISGLGLIRGKIRKFEGKaNLKVPHMGWNKLFDIKQKNSKLLKGIPNESFMYFIHSYRPVG 158
24212825  160 AEGNAITGLCDYYQEKFPAVVEKNNIFGTQFHPEKSHTHGLKLLENFIRFI 210
45656023  160 AEGNAITGLCDYYQEKFPAVVEKNNIFGTQFHPEKSHTHGLKLLENFIRFI 210
116329887 160 AEGNAITGLCDYYQEKFPAVVEKDNIFGTQFHPEKSHTHGLKLLENFIHFV 210
116326881 160 AEGNAITGLCDYYQEKFPAVVEKDNIFGTQFHPEKSHTHGLKLLENFIHFV 210
183220280 159 VDRLDITANCHYYGESFPAVVEKETIFGTQFHPEKSDKLGLGILKNFIEI- 208
189910398 159 VDRLDITANCHYYGESFPAVVEKETIFGTQFHPEKSDKLGLGILKNFIEI- 208
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap