Conserved Protein Domain Family
PRK14002

?
PRK14002: PRK14002 
K(+)-transporting ATPase subunit C
Links
?
Statistics
?
PSSM-Id: 172503
View PSSM: PRK14002
Aligned: 11 rows
Threshold Bit Score: 320.514
Threshold Setting Gi: 146299733
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
29347833    1 MKTLFKSLKITLVFCVFFSVFYILILWLFAQVAgPNKGNAEVATLDGKVVGAANVGQMFTKDIYFWGRPSCAgdGYDASS 80 
60680099    1 MKTLLKSIKITLVFCVFFSVFYILVLWLFAQVAgPNRGNAEVVTLNGKVVGAANVGQTFTEEKYFWGRPSCAgdGYDATS 80 
53711871    1 MKTLLKSIKITLVFCVFFSVFYILVLWLFAQVAgPNRGNAEVVTLNGKVVGAANVGQTFTEEKYFWGRPSCAgdGYDATS 80 
110638383   2 KSNILPSIKLTLVCLVFFMGIYTLAVYGIAQFT-PNNGNGDMIVHNGKIY-YSNIGQAFTDDSYFNSRPSAV--GYNAAG 77 
150010491   2 ISNLFKSLRLTIAFCLFFSVFYIFVLWLFAQVAgPNKGNAELVTLNGKVVGAANVGQNFTQDIYFWGRPSHAgdGYDASS 81 
150005772   1 MKNFIKSFRLTLVFCVFFSVCYILVLWIFAQFAgPNSGNAEVVELNGKVVGAANVGQSFTEDIYFWGRPSCAgdGYDATS 80 
150025738   1 MKNIFSILKLTFLMVVLFAVIYPLAIYGIAQFA-PNKGKGETISVNEKVVGYQKIGQKFDQSNYFWGRPSAV--DYNAAG 77 
146299733   1 MKNLFSLLKLTVFTLILFAVIYPLAIYGIAKLA-PNQGKGETISVNGKVVGYQKIGQKFDKSNYFWGRPSAV--DYNAAG 77 
187735647   1 MRNLVKSLRLTLVFCVFFSICYILVLWIFGLIVgPGGGNAETLVLNGRVVGAANVGQQFTKDIYFWGRPSHAgdGYDASS 80 
255034192   2 KQHILPAVRLTVVTLIFFSGVYTLAVLGAAQLF-PNQGKGEIIEQNGKRY-YANIGQSFTDDKYFNSRPSAV--GYNAAG 77 
255535264  27 KKHILPAVKLTAVILIFFAVLYPLTVWGIAQLV-PNNGKGDIIQHQGKKY-YTNIGQSFTQDNYFSSRPSAV--DYNAAG 102
29347833   81 SSGSNKGPTNPEYLAEVEARIDTFLVHHPYLSRKDVPAEMVTASASGLDPNITPQCAYVQVKRVAQARGLTENQVKEIVD 160
60680099   81 SAGSNKGPTNPEYLAEVEARIDTFLIHHPYLARKDVPAEMVTASASGLDPDITPQSAYVQVKRVAQARGMNVEEVRRVVD 160
53711871   81 SAGSNKGPTNPEYLAEVEARIDTFLIHHPYLARKDVPAEMVTASASGLDPDITPQSAYVQVKRVAQARGMDVEEVRRVVD 160
110638383  78 SGGSNKGPGNPDYLKEVQARIDTFLVHNPGVSKSEIPSDLVTASGSGLDPNISVQAAKVQIKRIANIRNIAEETLFQLIE 157
150010491  82 SAGSNKGPSNEEHLALLEERIDTFLVHHPYLTREKVPAEIITASSSGLDPHISPKAAYVQAKRVADARGWSEEKVMGIVN 161
150005772  81 SAGSNKGPTNAEYLAEVEARIDTFLKHHPYLSRKEVPAEMVTASGSGLDPDITPDCAYVQVQRVAKARGMSEETVKAIVD 160
150025738  78 SGGSNKAASNPDYLALVQKRIDTFLIAHPYLKKLEIPADMVTASGSGLDPNISPEGALIQVKRVAEVRKLSEEKVKALVE 157
146299733  78 SAGSNKGPSNADYLALVQKRIDTLLLVHPYLKKSDIPVDMVTASGSGLDPNISPQGALIQVKRIAKERMLDEAKVKSLVE 157
187735647  81 SSGSNKGPTNEEYLADVNIRIDSFLKKHPYLERKDVPSEMVTASASGLDPHITPESAYVQVKRVAKARGMEEGAVRSLVD 160
255034192  78 SGGSNKGPSNEEYLVVVQARIDTFLVHNPNVQEADIPVELVTASGSGLDPDISEKAALVQVERIAKIRNVPVQTLQDLVK 157
255535264 103 SGGSNKGPSNEEYLAEVQARIDTLLIMNPGMTKADIPVDMVTASGSGLDPHISVQAAKFQVKRIAKTRGIDPGKVEQLIV 182
29347833  161 QSVEKPLLGIFGTEKINVLKLNIALEENK 189
60680099  161 KAVEKPLLGIFGTEKVNVLKLNIALEELK 189
53711871  161 KAVEKPLLGIFGTEKVNVLKLNIALEELK 189
110638383 158 QQTEKPLLGLFGTEKINVLKLNIALDDLK 186
150010491 162 SHVEKPLLGMFGTEKVNVLKLNVALDQAS 190
150005772 161 KAVEKPFMGIFGTEKVNVLKLNAALEKAK 189
150025738 158 NKINKPTLA--GTSTVNVLELNVALDELK 184
146299733 158 SKINTAVV---GPETVNVLELNVALDQLK 183
187735647 161 QVVEKPLLGMFGTEKVNVLKLNIALEKAD 189
255034192 158 AHIQGPLLGMFGPEKVNVLRLNLALDQLK 186
255535264 183 DHTDQPLMGLFGPEKINVLKLNIALDQLK 211
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap