Conserved Protein Domain Family
PRK14001

?
PRK14001: PRK14001 
K(+)-transporting ATPase subunit C
Statistics
?
PSSM-Id: 172502
View PSSM: PRK14001
Aligned: 8 rows
Threshold Bit Score: 376.745
Threshold Setting Gi: 148660814
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
148660814   1 MRRQLLPALTMLLVFTVITGIVYPLAVTGVGQLFFGDQANGALLERDGQVIGSAHIGQQFTAAKYFHPRPSSAGDGYDAA 80 
148822240   1 MRRQLLPALTMLLVFTVITGIVYPLAVTGVGQLFFGDQANGALLERDGQVIGSAHIGQQFTAAKYFHPRPSSAGDGYDAA 80 
121636961   1 MRRQLLPALTMLLVFTVITGIVYPLAVTGVGQLFFGDQANGALLERDGQVIGSAHIGQQFTAAKYFHPRPSSAGDGYDAA 80 
15840461    1 MRRQLLPALTMLLVFTVITGIVYPLAVTGVGQLFFGDQANGALLERDGQVIGSAHIGQQFTAAKYFHPRPSSAGDGYDAA 80 
15608171    1 MRRQLLPALTMLLVFTVITGIVYPLAVTGVGQLFFGDQANGALLERDGQVIGSAHIGQQFTAAKYFHPRPSSAGDGYDAA 80 
31792223    1 MRRQLLPALTMLLVFTVITGIVYPLAVTGVGQLFFGDQANGALLERDGQVIGSAHIGQQFTAAKYFHPRPSSAGDGYDAA 80 
224989433   1 MRRQLLPALTMLLVFTVITGIVYPLAVTGVGQLFFGDQANGALLERDGQVIGSAHIGQQFTAAKYFHPRPSSAGDGYDAA 80 
253799938   1 MRRQLLPALTMLLVFTVITGIVYPLAVTGVGQLFFGDQANGALLERDGQVIGSAHIGQQFTAAKYFHPRPSSAGDGYDAA 80 
148660814  81 ASSGSNLGPTNEKLLAAVAERVTAYRKENNLPADTLVPVDAVTGSGSGLDPAISVVNAKLQAPRVAQARNISIRQVERLI 160
148822240  81 ASSGSNLGPTNEKLLAAVAERVTAYRKENNLPADTLVPVDAVTGSGSGLDPAISVVNAKLQAPRVAQARNISIRQVERLI 160
121636961  81 ASSGSNLGPTNEKLLAAVAERVTAYRKENNLPADTLVPVDAVTGSGSGLDPAISVVNAKLQAPRVAQARNISIRQVERLI 160
15840461   81 ASSGSNLGPTNEKLLAAVAERVTAYRKENNLPADTLVPVDAVTGSGSGLDPAISVVNAKLQAPRVAQARNISIRQVERLI 160
15608171   81 ASSGSNLGPTNEKLLAAVAERVTAYRKENNLPADTLVPVDAVTGSGSGLDPAISVVNAKLQAPRVAQARNISIRQVERLI 160
31792223   81 ASSGSNLGPTNEKLLAAVAERVTAYRKENNLPADTLVPVDAVTGSGSGLDPAISVVNAKLQAPRVAQARNISIRQVERLI 160
224989433  81 ASSGSNLGPTNEKLLAAVAERVTAYRKENNLPADTLVPVDAVTGSGSGLDPAISVVNAKLQAPRVAQARNISIRQVERLI 160
253799938  81 ASSGSNLGPTNEKLLAAVAERVTAYRKENNLPADTLVPVDAVTGSGSGLDPAISVVNAKLQAPRVAQARNISIRQVERLI 160
148660814 161 EDHTDARGLGFLGERAVNVLRLNLALDRL 189
148822240 161 EDHTDARGLGFLGERAVNVLRLNLALDRL 189
121636961 161 EDHTDARGLGFLGERAVNVLRLNLALDRL 189
15840461  161 EDHTDARGLGFLGERAVNVLRLNLALDRL 189
15608171  161 EDHTDARGLGFLGERAVNVLRLNLALDRL 189
31792223  161 EDHTDARGLGFLGERAVNVLRLNLALDRL 189
224989433 161 EDHTDARGLGFLGERAVNVLRLNLALDRL 189
253799938 161 EDHTDARGLGFLGERAVNVLRLNLALDRL 189
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap