Conserved Protein Domain Family
PRK13999

?
PRK13999: PRK13999 
K(+)-transporting ATPase subunit C
Statistics
?
PSSM-Id: 172500
View PSSM: PRK13999
Aligned: 19 rows
Threshold Bit Score: 333.638
Threshold Setting Gi: 90426019
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
163849688   1 MLNQLRPALVLLVALTAVTGLAYPLAVTGIAGALFPAKAAGSLIERDGRIIGSSLIGQSFTGEGYFHGRPSATNAADPAD 80 
192291783   1 MLKEVRPAVVSLLALTMITGLAYPLAVTGLATVLFPYQAQGSLVERGGKVVGSALIGQEFKGDEYFHGRPSATVAPDPAD 80 
148257575   1 MLKEVRPAILVMLALTLITGLLYPLAMTVVAGTIFPAQAEGSLITRSGQVIGSALIGQEFKDDKYFHGRLSATTAADPND 80 
146342661   1 MLKEIRPAIFVLLALTLITGLLYPLAMTGLAVTIFPAQAAGSLITRNGQVIGSALIGQEFKDDRYFHGRPSATSTADPND 80 
86751745    1 MLKEIRPAIVSFAALACLTGLIYPLAMTGIAQVAFPTQANGSLITQNNQVIGSALIGQSFTEPKYFHGRPSATTAPDPQD 80 
92118480    1 MLKELRPAIVILVALTIITGLIYPLAMTGAAQVLFPYQAQGSLIEQGGKTIGSALIGQSFTADRYFHGRPSATTAPDPKD 80 
90426019    1 MLKEIRPAIVLLLALTLLTGLAYPLAMTALAGVIFPKQAQGSLIEQDGQVIGSALIGQPFTEDKYFHGRPSATTAADPQD 80 
115526615   1 MLKEIRPALVMLVALTALTGLVYPLAMTGVAQLLLPAQANGSLIEQNGQVIGSALIGQAFTDARYFHGRPSATTAPDPQD 80 
27381888    1 MLREIRPAIVLLLVLTAITGLAYPLAMTGIAGMLFPAQAQGSLIEKDGKVIGSALIGQEFKDDKYFHGRPSATLAPDPND 80 
39936067    1 MLKEVRPAVVSLLALTMITGLAYPLAVTGLATVLFPYQAQGSLVERGGKVVGSALIGQEFKGDEYFHGRPSATVAPDPAD 80 
163849688  81 ASKTVPAPYNAASSAGSNLGPTSAALAERVKGDLAALKAENPGRPVPVDLVTTSGSGLDPDISPEAALFQVPRIARARNL 160
192291783  81 SSKTVSAPYNAANSGGSNLGPTSKALADRLSEDVAKLKAENPAAPIPVDLVTTSGSGLDPDISPEGALFQVPRVAKARGV 160
148257575  81 STKTVPAPYNAANSSGSNLGPTSKALADRLKEEVDKLKAENPGQPVPVDLVTTSASGLDPDISPEAALFQVPRVAKARGV 160
146342661  81 STKTVPAPYNAANSSGSNLGPTSKALADRVKEDVDKLKAENPAQPVPVDLVTTSASGLDPHVSPEAAMFQVPRVAKARGV 160
86751745   81 PAKSVPAPYNAANSMGSNLGPTSKALADRLASDMAALKQENPGAAVPVDLVTTSGSGLDPDVSPEAALFQVPRVAKARNL 160
92118480   81 ASKTVPAPYNAVNSMGSNLGPTSKALADRLRQDVATLKAQNPSAAVPVDLVTASGSGLDPDISPQAARFQVPRVAKARNL 160
90426019   81 SSKTVPAPYNAANSAGSNLGPTNKALIDRVKDDVDKLKAENPSAAVPVDLVTTSASGLDPDISPEAALFQVPRVAKARGL 160
115526615  81 SSKTVPSPYNAANSMGANLGPTSAALKERLTADVDAAKQDNPTSPVPVDLVTSSASGLDPDISPEAALFQVPRVAKARGI 160
27381888   81 STKTVSAPYNAANSGGSNLGPTSKALADRLKEDVDKLKAENPNAAVPVDLVTTSASGLDPDISPEAAQFQVPRVAKARNM 160
39936067   81 SSKTVSAPYNAANSGGSNLGPTSKALADRLSEDVAKLKAENPAAAIPVDLVTTSGSGLDPDISPEGALFQVPRVAKARGV 160
163849688 161 PEARLRDLVAGQVQGRTLGLLGEPRVNVLALNLVLDDLAKR 201
192291783 161 TEEQIRKLVGASIEQPLGGVLGESRVNVLKLNLALDAAAPR 201
148257575 161 PEASIRTLVAQQVKGRLLGLLGEPRVNVLALNLALDAAKLQ 201
146342661 161 PEDRVRALVVKNTEGRLIGLLGEPRVNVLALNLALDAATAT 201
86751745  161 PEARVRALVESQATGRDLGVLGEPRVNVLKLNLALDKMQAQ 201
92118480  161 PEAEVETLIDSRTEGRDLGFLGEPRVNVLKLNLALDRMAAS 201
90426019  161 SEERLRQLVSDHSKARLAGLLGEPRVNVLALNLALDAAK-- 199
115526615 161 DEAKLRALIDSQIQGRELGLLGEPRVNVLKLNLALDRMAA- 200
27381888  161 PEEAVKQLVASNVQGRLLGLLGEPRVNVLALNLALDRAAAK 201
39936067  161 PEEQIRKLVGASINQPLGGVLGEPRVNVLKLNLALDAAAPR 201
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap