Conserved Protein Domain Family
PRK13998

?
PRK13998: PRK13998 
K(+)-transporting ATPase subunit C
Statistics
?
PSSM-Id: 172499
View PSSM: PRK13998
Aligned: 15 rows
Threshold Bit Score: 361.342
Threshold Setting Gi: 82751678
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
49484301    1 MNTIRNSICLTIITMVLCGFLFPLAITLIGQIFFYQQANGSLITYDNRIVGSKLIGQHWTETRYFHGRPSAVDYNMNPEK 80 
49486869    1 MNTIRNSICLTIITMVLCGFLFPLAITLIGQIFFYQQANGSLITYDNRIVGSKLIGQHWTETRYFHGRPSAVDYNMNPEK 80 
21283728    1 MNTIRNSICLTIITMVLCGFLFPLAITLIGQIFFYQQANGSLITYDNRIVGSKLIGQHWTETRYFHGRPSAVDYNMNPEK 80 
87160061    1 MNTIRNSICLTIITMVLCGFLFPLAITLIGQIFFYQQANGSLITYDNRIVGSKLIGQHWTETRYFHGRPSAVDYNMNPEK 80 
88195976    1 MNTIRNSICLTIITMVLCGFLFPLAITLIGQIFFYQQANGSLITYDNRIVGSKLIGQHWTETRYFHGRPSAVDYNMNPEK 80 
151222192   1 MNTIRNSICLTIITMVLCGFLFPLAITLIGQIFFYQQANGSLITYDNRIVGSKLIGQHWTETRYFHGRPSAVDYNMNPEK 80 
148268527   1 MNTIRNSICLTIITMVLCGFLFPLAITLIGQIFFYQQANGSLITYDNRIVGSKLIGQHWTETRYFHGRPSAVDYNMNPEK 80 
150394591   1 MNTIRNSICLTIITMVLCGFLFPLAITLIGQIFFYQQANGSLITYDNRIVGSKLIGQHWTETRYFHGRPSAVDYNMNPEK 80 
161510287   1 MNTIRNSICLTIITMVLCGFLFPLAITLIGQIFFYQQANGSLITYDNRIVGSKLIGQHWTETRYFHGRPSAVDYNMNPEK 80 
156980391   1 MNTIRNSICLTIITMVLCGFLFPLAITLIGQIFFYQQANGSLITYDNRIVGSKLIGQHWTETRYFHGRPSAVDYNMNPEK 80 
49484301   81 LYKNGVSSGGSNESNGNTELIARVKHHVKFDNSNVTIDAATSSGSGLDPHITVENALKQAPRIADARHISTSRVADLIQH 160
49486869   81 LYKNGVSSGGSNESNGNTELIARMKHHVKFGNSNVTIDAATSSGSGLDPHITVENALKQAPRIADARHISTSRVADLIQH 160
21283728   81 LYKNGVSSGGSNESNGNTELIARMKHHVKFGNSNVTIDAATSSGSGLDPHITVENALKQAPRIADARHISTSRVADLIQH 160
87160061   81 LYKNGVSSGGSNESNGNTELIARMKHHVKFGNSNVTIDAATSSGSGLDPHITVENALKQAPRIADARHVSTSRVADLIQH 160
88195976   81 LYKNGVSSGGSNESNGNTELIARMKHHVKFGNSNVTIDAATSSGSGLDPHITVENALKQAPRIADARHVSTSRVADLIQH 160
151222192  81 LYKNGVSSGGSNESNGNTELIARMKHHVKFGNSNVTIDAATSSGSGLDPHITVENALKQAPRIADARHVSTSRVADLIQH 160
148268527  81 LYKNGVSSGGSNESNGNTELIARMKHHVKFGNSNVTIDAATSSGSGLDPHITVENALKQAPRIADARHVSTSRVADLIQH 160
150394591  81 LYKNGVSSGGSNESNGNTELIARMKHHVKFGNSNVTIDAATSSGSGLDPHITVENALKQAPRIADARHVSTSRVADLIQH 160
161510287  81 LYKNGVSSGGSNESNGNTELIARMKHHVKFGNSNVTIDAATSSGSGLDPHITVENALKQAPRIADARHVSTSRVADLIQH 160
156980391  81 LYKNGVSSGGSNESNGNTELIARMKHHVKFGNSNVTIDAATSSGSGLDPHITVENALKQAPRIADARHVSTSRVADLIQH 160
49484301  161 RKQRGVLTNDYVNVLELNIALDKMKD 186
49486869  161 RKQRGVLTNDYVNVLELNIALDKMKD 186
21283728  161 RKQRGVLTNDYVNVLELNIALDKMKD 186
87160061  161 RKQRGVLTNDYVNVLELNIALDKMKD 186
88195976  161 RKQRGVLTNDYVNVLELNIALDKMKD 186
151222192 161 RKQRGVLTNDYVNVLELNIALDKMKD 186
148268527 161 RKQRGVLTNDYVNVLELNIALDKMKD 186
150394591 161 RKQRGVLTNDYVNVLELNIALDKMKD 186
161510287 161 RKQRGVLTNDYVNVLELNIALDKMKD 186
156980391 161 RKQRGVLTNDYVNVLELNIALDKMKD 186
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap