Conserved Protein Domain Family
PRK13997

?
PRK13997: PRK13997 
K(+)-transporting ATPase subunit C
Statistics
?
PSSM-Id: 172498
View PSSM: PRK13997
Aligned: 20 rows
Threshold Bit Score: 369.309
Threshold Setting Gi: 152974451
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
163938662   1 MAKKQSILSPIIRITFTFLVLCGLVYPLIVTGIAQAVMKDNADGSLIYNDKDEVVGSKLIGQNFTDPRYFHGRVSSIEYK 80 
30018914    1 MEKKQSILSPIIRITFTFLVLCGLVYPLIVTGIAQAVMKDNADGSLIYNDKNEVIGSKLIGQNFTDPRYFQGRVSSIEYK 80 
52144574    1 MAKKQSILSPIIRITFTFLVLCGLVYPLIITGIAQAVMKDNADGSLIYNDKNEVIGSKLIGQNFTDPRYFHGRVSSIEYK 80 
42779888    1 MAKKQSILSPIIRITFTFLVLCGLVYPLIVTGIAQAVMKDNADGSLIYNDKNEVIGSKLIGQNFTDPRYFHGRVSSIEYK 80 
217958323   1 MAKKQSILSPIIRITFTFLVLCGLVYPLIVTGIAQAVMKDNADGSLIYNDKNEVIGSKLIGQNFTDPRYFHGRVSSIEYK 80 
218235311   1 MEKKQSILSPIIRITFTFLVLCGLVYPLIVTGIAQAVMKDNADGSLIYNDKNEVIGSKLIGQNFTDPRYFQGRVSSIEYK 80 
218895796   1 MEKKQSILSPIIRITFTFLVLCGLVYPLIVTGIAQAVMKDNADGSLIYNDKNEVIGSKLIGQNFTDPRYFQGRVSSIEYK 80 
222094493   1 MAKKQSILSPIIRITFTFLVLCGLVYPLIVTGIAQAVMKDNADGSLIYNDKNEVIGSKLIGQNFTDPRYFHGRVSSIEYK 80 
225862718   1 MAKKQSILSPIIRITFTFLVLCGLVYPLIVTGIAQAVMKDNADGSLIYNDKNEVIGSKLIGQNFTDPRYFHGRVSSIEYK 80 
301052383   1 MAKKQSILSPIIRITFTFLVLCGLVYPLIVTGIAQAVMKDNADGSLIYNDKNEVIGSTLIGQNFTDPRYFHGRVSSIEYK 80 
163938662  81 AEASGSNNYAPSNPDLAKRVEKSIDDWKKQNRAIPVTEVPIDLVTNSGSGLDPDISPKAASVQVDRISKLTNIPKEKLDQ 160
30018914   81 AEASGSNNYAPSNPDLEKRVEKSIEEWKKQNPSVPVTEVPIDLVTNSGSGLDPDISPKAASVQVDRISKLTDIPKEKLNQ 160
52144574   81 AEASGSNNYAPSNPDLEKRVEKSIEEWKKQNPSVPVTEVPIDLVTNSGSGLDPDISPKAASVQVERISKLTKIPKETLEQ 160
42779888   81 AEASGSNNYAPSNPDLEKRVEKSIEEWKKQNPTVPVTEVPIDLVTNSGSGLDPDISPKAASVQVERISKITNIPKETLNQ 160
217958323  81 AEASGSNNYAPSNPDLEKRVEKSIEEWKKQNPSVPVTEVPIDLVTNSGSGLDPDISPKAASVQVERISKITNIPKETLNQ 160
218235311  81 AEASGSNNYAPSNPDLAKRVEKSIADWKEKNPAVPVTEIPIDLVTNSGSGLDPDISPKAASVQVDRISKLTNIPKEKLNQ 160
218895796  81 AEASGSNNYAPSNPDLEKRVEKSIEEWKKQNRAVPVTEVPIDLVTNSGSGLDPDISPQAASVQVDRISKLTNITKETLNQ 160
222094493  81 AEASGSNNYAPSNPDLEKRVEKSIEEWKKQNPSVPVTEVPIDLVTNSGSGLDPDISPKAASVQVERISKITNIPKETLNQ 160
225862718  81 AEASGSNNYAPSNPDLEKRVEKSIEEWKKQNPSVPVTEVPIDLVTNSGSGLDPDISPKAASVQVERISKLTKIPKETLEQ 160
301052383  81 AEASGSNNYAPSNPDLEKRVEKSIEEWKKQNPSVPVTEVPIDLVTNSGSGLDPDISPKAAYVQVERISKLTKIPKETLEQ 160
163938662 161 LIKDQTEGAALGLFGEDRVNVLKLNLELQKLMK 193
30018914  161 LIKDQTEGAALGLFGETRVNVLKLNLALQELMK 193
52144574  161 LIQDQTEGAALGLFGETRVNVLKLNLELQKLLK 193
42779888  161 LIKDQTEGAALGLFGETRVNVLKLNLELQKLLK 193
217958323 161 LIKDQTEGAALGLFGENRVNVLKLNLELQKLMK 193
218235311 161 LIKDQTEGAALGLFGETRVNVLKLNLALQKLMK 193
218895796 161 LIKDQTEGAALGLFGENRVNVLKLNLELQKLLK 193
222094493 161 LIKEQTEGAALGLFGENRVNVLKLNLELQKLLK 193
225862718 161 LIKDQTEGAALGLFGETRVNVLKLNLELQKLMK 193
301052383 161 LIKDQTEGAALGLFGETRVNVLKLNLELQKIMK 193
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap