Conserved Protein Domain Family
PRK13996

?
PRK13996: PRK13996 
potassium-transporting ATPase subunit C; Provisional
Links
?
Statistics
?
PSSM-Id: 172497
View PSSM: PRK13996
Aligned: 4 rows
Threshold Bit Score: 340.706
Threshold Setting Gi: 188589515
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
110800229   1 MKIIRKSILAVLVFTILCGIIYPVSTTVLAQVLFKEEANGSIIEVDGKKYGSELLGQQFTDNKYLWGRIMNINVEMFKDS 80 
187934712   5 KAVFPKALIIFMIFTILCGGIYTIFITGISQLIFPKQANGSIIEVNGKKYGSVLLAQQYNDEKHLWGRIMNIDTDTFVDD 84 
188589515   5 KAVFPKALIIFIIFTILCGGIYTIFITGISQLIFPKQANGSIIEVNGKKYGSVLLAQQYNDEKHLWGRIMNIDTNTFVDE 84 
257792574   9 AKTWGSAALFFLVTTVLCGVIYTAACTGLAQLFFPHQANGSIIEVDGTKYGSELVGQRFTDEKHLWGRAMNPSTGTFTDA 88 
110800229  81 NGKPLMYSSPSNLSPASEEYEKLVKERVERIRSYNKGKEEEPIPVDLVTSSGSGLDPHISVAAAKYQVDRIAKERNLSVD 160
187934712  85 NGKKLAYSAPSNLSPASKEYEALVKERVDKIKANHPEQDDKAIPVDLVTCSGSGLDPHISVAAAKYQVNRIAKNNNMKIK 164
188589515  85 NGKKLAYSAPSNLSPASKEYEALVQERVDKIKENHPEQDEQAIPVDLVTCSGSGLDPHISVAAAKYQINRIAKNNNMEVK 164
257792574  89 EGNDVLWYAPSNLSPAGDEFATAVQDRVEQIRAAHPEMGNKPIPSDLVTNSGSGFDPHISPAAAEYQVDRLARTTGKSAS 168
110800229 161 YVNEIIDKYTTGRFLGIFGEKTVNVLKVNLALDGILR 197
187934712 165 DVEKIIDKYTSGKLFGVLGEKTVNVLEVNLAIDGILK 201
188589515 165 DVENIIDKYTSGKLFGVLGEKTVNVLEVNLAIDGILK 201
257792574 169 EIRDIIKQCTEQPQFGFLGDARVNVLKVNLMLDGVL- 204
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap