Conserved Protein Domain Family
PRK13991

?
PRK13991: PRK13991 
cell division topological specificity factor MinE; Provisional
Statistics
?
PSSM-Id: 172493
View PSSM: PRK13991
Aligned: 6 rows
Threshold Bit Score: 143.484
Threshold Setting Gi: 219850624
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
159899940  1 MGLLDNLFGrKQQNSSSVAKERLLTVLVHDRVHLTPHDMEEMKREIIAVIERYVEVTNPEAIEVTLTRGEAADHLKADIP 80 
156743347  1 MSFLDSLFG-KRQRSSDIARDRLLTVLVHDRVKLTPDMMEQLKAELSTVIARYVPSVDAGAIEVTLMRGEAVDHLKADIP 79 
163845610  1 MSFLNGLFGrKRDSSAELAKQRLLTVLIDDRYKLTPEMMAQMKADLAEVLKRYLPAIDAEQIEVTLSRGEAHDLLKADVP 80 
148655694  1 MSFLDTLFG-KRERSSDIARDRLLTVLVHDRVKLTPDMMEQLKADLSAVIARYVPSVDAGAIEVTLLRGESVDHLKADIP 79 
219850624  1 MSFLNGLFGrKRDSSAELAKQRLLTVLIDDRYKLTPEMMAQMKADLAEVLKRYLPAIDAEQIEVTLSRGEAHDLLKADVP 80 
222523309  1 MSFLNGLFGrKRDSSAELAKQRLLTVLIDDRYKLTPEMMAQMKADLAEVLKRYLPAIDAEQIEVTLSRGEAHDLLKADVP 80 
159899940 81 LGRSRQQ 87 
156743347 80 LRRTSQK 86 
163845610 81 LRRATDH 87 
148655694 80 LRRTTQK 86 
219850624 81 LRRTSEG 87 
222523309 81 LRRATDH 87 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap