Conserved Protein Domain Family
PRK13990

?
PRK13990: PRK13990 
cell division topological specificity factor MinE; Provisional
Statistics
?
PSSM-Id: 172492
View PSSM: PRK13990
Aligned: 9 rows
Threshold Bit Score: 135.639
Threshold Setting Gi: 56708627
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
56708627   1 MLAKLFGLSKKQQSASVAKERLQIIVAHQRSELHPRSSKISSHLLAELKDEIIEVVKKYVALSEENIRDIDLKVEDSSKN 80 
110671098  1 MLAKLFGLSKKQQSASVAKERLQIIVAHQRSELHPRSSKISSHLLAELKDEIIEVVKKYVALSEENIRDIDLKVEDSSKN 80 
89255925   1 MLAKLFGLSKKQQSASVAKERLQIIVAHQRSELHPRSSKISSHLLAELKDEIIEVVKKYVALSEENIRDIDLKVEDSSKN 80 
115314407  1 MLAKLFGLSKKQQSASVAKERLQIIVAHQRSELHPRSSKISSHLLAELKDEIIEVVKKYVALSEENIRDIDLKVEDSSKN 80 
118496939  1 MLAKLFGLSKKQQSASVAKERLQIIVAHQRSELHPRSSKISSHLLAELKDEIIEVVKKYVALSEENIRDIDLKVEDSSKN 80 
134301427  1 MLAKLFGLSKKQQSASVAKERLQIIVAHQRSELHPRSSKISSHLLAELKDEIIEVVKKYVALSEENIRDIDLKVEDSSKN 80 
167626715  1 MLAKLFGLGKKQQSASLAKERLQIIVAHQRNELHPRSSKISSHLLAELKDEIIEVVKKYVALSEDNIRDIDIKVEDSSKN 80 
156501914  1 MLAKLFGLSKKQQSASVAKERLQIIVAHQRSELHPRSSKISSHLLAELKDEIIEVVKKYVALSEENIRDIDLKVEDSSKN 80 
187931160  1 MLAKLFGLSKKQQSASVAKERLQIIVAHQRSELHPRSSKISSHLLAELKDEIIEVVKKYVALSEENIRDIDLKVEDSSKN 80 
56708627  81 STIEVNIPFN 90 
110671098 81 STIEVNIPFN 90 
89255925  81 STIEVNIPFN 90 
115314407 81 STIEVNIPFN 90 
118496939 81 STIEVNIPFN 90 
134301427 81 STIEVNIPFN 90 
167626715 81 STIEVNIPFN 90 
156501914 81 STIEVNIPFN 90 
187931160 81 STIEVNIPFN 90 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap