Conserved Protein Domain Family
PRK13984

?
PRK13984: PRK13984 
putative oxidoreductase; Provisional
Statistics
?
PSSM-Id: 172486
View PSSM: PRK13984
Aligned: 9 rows
Threshold Bit Score: 1069.77
Threshold Setting Gi: 117925495
Created: 9-Dec-2010
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
154250402   1 MAEKSFFAPLIAWKNLFEKPVTIRVPKe---KREAAERYRGFHINDWNKCIGCGTCAKICPTDAITMVEVPDMKQEYGMK 77 
117925495   1 MTIRDVLSPFTAWKNLFREPVSIKDPI----HRKAAPRYRGFHKNDVEKCIGCGTCEAICQNGAIDMVENRDVPGNRSDS 76 
15643973    9 LPEKDFFAPLKAWKFLVRKPVTIEVPNk--iRREASERYRGFHVNDWGKCIGCGTCAKICPTDAITMVEVPDLTQEDGKL 86 
170289382   6 LPEKDFFAPLKAWKFLVRKPVTIEVPNk--iRREASERYRGFHVNDWGKCIGCGTCAKICPTDAITMVEVPDLTQEDGKL 83 
160902350   3 TPEKSFFAPARAWKYLTKKPVTVPMENilitPREASDRYRGFHINDWEKCIGCGTCSKICPTDAITMIEIEELSDVEGSK 82 
150021107   6 ISKKEFFSPISAWKFLLKKPVTIKVPYv---KREAAERYRGFHINDWNECIGCGTCSKICPTDAIKMVEIEDLPQQYGEK 82 
217077743   6 TPKKEFFAPIKAWKYMFRKPVTIKVPYv---KREAAERYRGFHINDWEKCIGCGTCAKICPTDAIRMVEVEGLAQEYGKK 82 
222100328   9 LPKKDFFAPLKAWKFLARKPVTIEVPNk--tKREASERYRGFHVNDWGKCIGCGTCSKICPTDAITMVEVPDLTQEDGKL 86 
239618411   6 IFKKTFWGPTIAWKYLFAKPITITVPKv---YREAAERYRGFHINDWELCTGCGTCSKICPTDAIKMIPV-DIETEPGEK 81 
154250402  78 PQRPAIDYGRCSFCAMCVDICTTGSLQMTREYIFVSPNPEDFYYAPtekGILKK----EPSEIKIGWTREDTNDLLDLDR 153
117925495  77 GLRPRIDYGRCCWCALCVDVCMTSSLTMSNAYQWVDSDPKAFMFTP---GVDPK----YWDNMEQGYRRPEGHRLTPAAR 149
15643973   87 PQRPVIDYGRCSFCALCVDICTTGSLKMTREYIHISEDPEDFIFMPtdkGLNAKkglyEFGKAPLGWVRDENSELLDLER 166
170289382  84 PQRPVIDYGRCSFCALCVDICTTGSLKMTREYIHISEDPEDFIFMPtdkGLNAKkglyEFGKAPLGWVRDENSELLDLER 163
160902350  83 PQRPSIDYGRCSFCGLCVDICTTGSLQMTKEYLHISKDPNTFFFIPteeGI-------HGIRKPLGYVRDENSDLLDLER 155
150021107  83 PQRPVIDYGRCSFCAMCVDICTTGSLKMTREYVHISPNPEDFIFAPtegGIH------GVKDVPVGWTRDDDSDLLELER 156
217077743  83 PQRPVIDYGRCSFCAMCVDICTTSSLKMTREYVHISPDPEDFIFAPtekGIH------GVDEVPVGWTRDENSELLELDR 156
222100328  87 PQRPVIDYGRCSFCALCVDICTTGSLQMTREYIHISEDPEDFVFMPtdkGLNAKrglyEPGKAPLGWTRDKDSELLDLER 166
239618411  82 AEKPAIDYGRCSFCGMCVDICTTGSLKMTREYIHISDNPNTFFFMPesdGI-------HHNNFPIGYVRDEDSELLDLER 154
154250402 154 VVPEHMPAEERVDSFVEFVKAYSKEEAIKEAARCVECAICVDRCPEHMQIPQYIKSIWKDDLKDALKWLLKgveeqnnfg 233
117925495 150 VHMHEMEAEERLDSFTEIVDGYSVTDAQFEADRCVACGLCVATCPAHMSIPDYIAAVRDGDYERGLALLYE--------- 220
15643973  167 IEMPVEPPEVRIKSFIEIVKGYSREQAMQEAARCVECGVCTYTCPEHMDIPQYIKSVYEDNLEEGLRWLYR--------- 237
170289382 164 IEMPVEPPEVRIKSFIEIVKGYSREQAMQEAARCVECGVCTYTCPEHMDIPQYIKSVYEDNLEEGLRWLYR--------- 234
160902350 156 EEMEIDPPEIRKTSFIEMVKGFSKEQAVKEASRCVGCSICEKTCPAHMNIADYITDIYTDDLQTGLKDLYK--------- 226
150021107 157 VEMGMIEGEERSKSFIEYVKGYSKEQAMHEASRCVECGICTDRCPQHMQIPEYIKAIWKDDLKDALRWLLKgdesnnmvg 236
217077743 157 VEMEMIEGEERSKSFIEYVKGYSKEQAIHEAARCVECGICTDRCPQHMRIPEYIKAIWKDDLKEAVNILLKgdleqdmlg 236
222100328 167 VEMTKEPPETRVRSFIEIVKGYSREQAMQEAARCVECGVCTYTCPEHMDIPQYIKSIYEDDLEEGLRWLYR--------- 237
239618411 155 VEMEEIPGAERVNSFIEFVKGYSKEQAIAEAARCVDCELCTDVCPAHMDIPEYIETVFNDDLKRGVEWIYK--------- 225
154250402 234 ANPLSGVCGRVCTHRCEEVCAISHRGEAIAIRWLKRYIVDNVPANQWSEIVKFESPKK-NKKVGIIGSGPAGLSAAYFLA 312
117925495 221 TNPFSNVCGRVCTHKCETVCAVNHEGEPIAIRWLKRHIADQVPVEKYRQIIGDPAPAV-GKKVAVVGAGPAGLTAAFDLA 299
15643973  238 TNPLSMVCGRVCTHRCETACSVGVRGEPVAIQWLKRYIVDSIPLERYGEILDIKPERK-GKSVGIIGSGPAGLAAAYFLA 316
170289382 235 TNPLSMVCGRVCTHRCETACSVGVRGEPVAIQWLKRYIVDSIPLERYGEILDIKPERK-GKSVGIIGSGPAGLAAAYFLA 313
160902350 227 TNPLPAVCGRMCTHKCETVCTIGHRGEPIAIRWLKRYIVDNVPQDKYPEILDQEVIKKaNAKVAIVGAGPAGLSAAYFLS 306
150021107 237 ANPFSAVCGRVCTHKCEEACSLGNRGEAIAIRWLKRYIVDNVP--DYEKVLEVNTVKK-DKKVAIVGSGPAGLSAAYFLA 313
217077743 237 ANPFSSVCGRVCTHKCEEACSIGNRGDAIAIRWLKRYIVDNIS--SYENVVDYKIEPR-NKKVAIVGSGPAGLSAAYFLA 313
222100328 238 TNPLSMVCGRVCTHRCETACSIGVRGEPVAIQWLKRYIVDSVPLEEYSRILDMKPEKK-GKSIGIIGSGPAGLSAAYFLA 316
239618411 226 TNPLPGVCGRVCTHNCEAVCSIGHRGEAVAIRWLKRYIIDQTPVEEIKKVANEEIIKKaNKKVAIIGSGPSGLAAAYYLS 305
154250402 313 TMGYEVDIYESLNRPGGVMRYGIPRYRLPDEALDKDIAFIEALGVRIYTGVTVGKDIPFEEFRQKYDAIFVSTGLTLGRS 392
117925495 300 KMGYQVEVYEARPKPGGMFRYGIPEYRLPYDMMDRDIDVITSMGVNIHCNMRVGHDIAMEQLREGHDAVLLTIGLHLGRS 379
15643973  317 TMGYDVTIYESESKPGGVMRYGIPKYRLPDEALDKDIAFIEALGVKILLNTRVVQDVSFEDVRKRHDVVFLATGFGLGRS 396
170289382 314 TMGYDVTIYESESKPGGVMRYGIPKYRLPDEALDKDIAFIEALGVKILLNTRVVQDVSFEDVRKRHDVVFLATGFGLGRS 393
160902350 307 LMGYEITVYEEKNRPGGVLNYGGPSYRLPDTAFEQDVNYIKSLGVKIITNTKVGKDITLEELKAKNDVIFVSTGFNKGRK 386
150021107 314 TLGYEVEVFESLSKPGGVMRYGIPSYRLPDEALDKDIAFIQALGVKIHVGVSVGKDISLEKLREKYDAVFVSTGFTLGRS 393
217077743 314 TMGYEVEVFESLSRPGGVMRYGIPSYRLPDEALDKDIAFIQALGVKIHVGVSVGKDIPLMELKEKFDAVYVSTGFTLGRS 393
222100328 317 TMGYDVTVYEAESRPGGVMRYGIPKYRLPDEALDKDIAFIEALGVRFVLNTRVGQDIPFEELRKKHDAIFLATGFGLGRS 396
239618411 306 LMGYKVTIFEAKPKAGGVMRYGIPRYRLPDEALDKDIEVIQSLGVEIKLNTTVGKDVTLEQLKKEYDAVFLGTGFTIGKS 385
154250402 393 TRMPGSDHPNVVQALPLLREIRdylrgEGPEPKIARRVVVIGGGNVAMDIARSLARLQKMKYGEVNVTVTCLErTFDEMP 472
117925495 380 TRIPGSDHPNVTKAIDLLRQIT-----EGQQIEVPRQLVVIGGGNVAMDIARSVARLQKQSYGEIKVTLTALE-DRAHFL 453
15643973  397 TGVPGTDHPDVKQALPLLKMIRdylrgDGPKPPVPERLVVIGGGNVAMDISRSMARLQFMEYGRVNVQVLSLEgCFEDMP 476
170289382 394 TGVPGTDHPDVKQALPLLKMIRdylrgDGPKPPVPERLVVIGGGNVAMDISRSMARLQFMEYGRVNVQVLSLEgCFEDMP 473
160902350 387 LPIEGSDHENVFDSLTILEEMKnyvrgEGPKPYIPKSLVVIGGGNVAMDVARSMLRLQNLEYKKSEVHVLSLErSFDEMP 466
150021107 394 TKVPGTEHEDVIQALPLLREIRdylrgEGPKPKIPRSLVVIGGGNVAMDVARSMARLQKMEYGKVDVKITSLErTYEEMP 473
217077743 394 TNIPGTEHEDVIQALPLLREIRdflrgEGPKPKIPKSLVVIGGGNVAMDVARSMARLQMMEYGKVDVKVSSLErTYEEMP 473
222100328 397 TGVPGTDHPDVKQALPMLKMIRnylrgDGPKPPIPEKLVVIGGGNVAMDISRSMARLQVMEYGTVNVQVLSLEgCFEDMP 476
239618411 386 TKIPGTEHEKVIQALPLLEKIRdylrgEGEKPEIPNSLIVIGGGNVAMDVARSMARLQKMEGKEVNVKVVCLE-TMEEMP 464
154250402 473 ADMEEIEEAQEEGVKIYPGWGPREVVFypNEDKIKGIKCVKCTEVFDENRKFNPKFDETEICYYDGDMIIEAIGQAPDYS 552
117925495 454 ADPDEIRESLEEGIEILDARGPQEILVd-DNGALVGLRTLRVLAIFDSEGRFAPSYDESDERIHPANMISEAIGQMSDTE 532
15643973  477 ADMEEIEEALEEGIVINPGWGPMEVVI--ENDRIKGVKFKKCVSVFDGEGRFNPQFDEKEQIFVEADMVVEAIGQAPDYS 554
170289382 474 ADMEEIEEALEEGIVINPGWGPMEVVI--ENDRIKGVKFKKCVSVFDGEGRFNPQFDEKEQIFVEADMVVEAIGQAPDYS 551
160902350 467 ADEDEIVEGKEEGVNFHPGWGPVKVIV--ENGEVKGVLFRKCVEVFDEDGRFNPKYDESNTITVNADMVVMTVGQAPDYS 544
150021107 474 ADMEEIEEGSEEGVAFYPGWGPMKIVI--ENDKVKGVELKKCLEVFDENGRFNPRFDESNKMVLDADMVVEAIGQAPDYD 551
217077743 474 ADMEEIEEGAEEGVKFYPGWGPIRIII--EDDKVKGVEFKKCLEVFDENRRFNPKFDENKKMVLDADMVVEAIGQAPDYS 551
222100328 477 ADMEEIDEALEEGVVIKPGWGPVEVVI--ENDRVKGVRFKKCVKVFDDEGRFNPKFDESIQIFVEADMVVEAIGQAPDYS 554
239618411 465 ADLEEIVEGKEEGILFFPSRGPSEVIV--ENGEIKGLKTVCCTSVFDENGRFNPTFDEKDVIIIEGDMIVEAIGQAPDYS 542
154250402 553 FLPEEWKSKLQFVGPRILTNNLRQTQ-IPWLFAGGDIVNGPDIIHAVADGYWAARGIDQYLSNQ 615
117925495 533 LLGEPLKEALEWNRGRIAVDGMGRTS-EPWLWAAGDCVKGPDVIHAVADGHRAAESIDAAIKGQ 595
15643973  555 YLPEEIRSKLEFFRGRIKTNEYNQTS-VEWLFAGGDIVHGPDIIHGIADGYAAAKGIDMYLRKE 617
170289382 552 YLPEEIRSKLEFFRGRIKTNEYNQTS-VEWLFAGGDIVHGPDIIHGIADGYAAAKGIDMYLRKE 614
160902350 545 YLPEEIQKNMKIERGKIKTNEYGQVEgVPWLFAGGDIVHGPDVIHGVADGHKAAQGIDQYIMEK 608
150021107 552 YLPEEVKSKIEFVRGRLLTNEYRQTS-VEWLFAGGDIVHGPDIIHAVADGYWAARGIDKFLSKG 614
217077743 552 YLPEELKEKLEFVRGRIVTNEYRQTS-IKWLFAGGDIVHGPDIIHGVADGYWAAKGIDEYLRSE 614
222100328 555 YLPQEIKEKLEFVRGRIRTNEYGQTS-IEWLFAGGDIVHGPDIIHGVADGYAAARGIDMYLRKA 617
239618411 543 YLPEELKSKLEFTRGRILVNEYGQTS-IPWLFAGGDIVHGPDIINGIADGHRAAEGIDRYLNQ- 604
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap