Conserved Protein Domain Family
PRK13982

?
PRK13982: PRK13982 
bifunctional SbtC-like/phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Provisional
Statistics
?
PSSM-Id: 172484
View PSSM: PRK13982
Aligned: 16 rows
Threshold Bit Score: 759.289
Threshold Setting Gi: 153008650
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
86747748    1 MANLTIRKLDDALKAELRQRAAGNGRSMEDEVRVILRDAVHQRHGFATSLPQAGGAAAEPGPGDVSPENqtafvsdrpsT 80 
146337250   1 MASLTIRKLDDSLKTYLRLRSAQNGRSVEEEVRVILRALIEPVDPSEPPAAAPSPAALPDPGLPQPGLAr---------E 71 
148251705   1 MASLTIRKLDETLKTYLRLRSAQNGRSVEEEVRVILRGLIEPADPSEPPSAPPTPAPPPEPMVPQPGVAr---------E 71 
90421904    1 MASLTIRKLDEAIKAELRQRAARHGRSMEDEVRTILRDAAQPRHEFAASFDEAVSQPVAPAPEPVAATG----------Q 70 
92115683    1 MASLTVRKLDDAIKAELRLRAARNGRSVEDEVRVILREAATVTSSTVATGNRAARNAAIPAGRNSFHQSn--------gL 72 
75674242    1 MASLTVRKLDDAVKARLRARAAVSGRSVEEEIRVILREA---------TVIPPPTAFDDPASRNAASLRdkgffnvssrL 71 
49473718    1 MASLTIRNLSPEVKEALRIRAAQNGVSMEEEARRLLSNFTTPTISSQASTVEMQSLK----------------------S 58 
163867342   1 MASITIRNLSPEIKEALRVRAAQNGISMEEEVRRLLSNPTTFTTHPSHVSAVEVQSLK---------------------S 59 
209883642   1 MASLTVRKLDDAIKTALKLRAAQSGRSVEDELRVILRQAAFEDSAPLPPAAAPETPSPPLQAPEG--------------R 66 
229220679   1 MASLTIRKLDEHVKTYLRLRSAKNHRSLEEEVRVILRELIEGREEPLTPFAVPPTASTAPTPQRTGALA----------E 70 
86747748   81 ARITLIVGGGIAAYKAMDLIRRLKERGAEVRVVLTKAAQHFVTPLTASALSHQRCYTDLFDPQSEFDAGHIRLARDCDLI 160
146337250  72 ARVTLIIGGGIAAYKSLDLIRRLRERYIQVRCVMTRAATQFVTELAASALSGDRVFTDLFDARSEFDVGHIRLARDCDLI 151
148251705  72 ARVTLIIGGGIAAYKSLDLIRRLKERHIQVRCVLTKAATQFVTELAASALSGERVFTDLFDARSEFDVGHIRLARDCDLI 151
90421904   71 PRMTLIVGGGIAAYKSMDLIRRLMERGFTVRCVLTKAAQQFVTPLTASALSHQRCYTDLFDPASEFDAGHIRLGRDCALI 150
92115683   73 RNITLIIGGGIAAYKALDLIRRLKERGFIVRCVMTNAAQQFVTPLSAGALAGTHAYTDLFDPGSEFDAGHIRLARDCDLI 152
75674242   72 TKVTVIVGGGIAAYKALDLIRRLRERGFFVRCVMTNAAQQFVTPLSAGSLSNERCYTDLFDASSEFDAGHIRLARDCDLI 151
49473718   59 KSILLIIGGSIAAYKMLDLIRRLQERGARLNIIMTKAAQKFITPLAAEALSGCTVHSDLFSREEEHDIGHIRLARCADLI 138
163867342  60 KSLLLIIGGSIAAYKALDLIRRLKERGAHLNIIMTKAAQKFITPLAAEALNGRTVYTDLFSREEEHDIGHIRLAREADLI 139
209883642  67 YRVTLIIGGGIAAYKALDLIRRLKECGCEVRCVLTRAAERFVTALSASALAGSPCHTDLFDPTSEFDAGHIRLARHCDLV 146
229220679  71 ASVTLIIGGGIAAFKSLDLIRRLKERRIEVRCVLTNAAQQFVTPLSVSALSHERVYTDLFDPQSEFDAGHIRLARDCDLI 150
86747748  161 VVAPATADLMAKIANGHADDLATAILLATNRQVLLAPAMNPLMWANAATRRNVDQLKRDGIVLVGPNAGEMAERNEAGTG 240
146337250 152 VVAPATADLMSKMAQGAADDLASAILLAASRPILLAPAMNPMMWSNPATRRNAATLQRDGIHMIGPNAGEMAEKGEAGVG 231
148251705 152 VVAPATADLMAKMAQGLASDLASAVLLAASRPILLAPAMNPMMWSNPATRRNAATLQRDGIQMIGPNAGEMAEKGEAGVG 231
90421904  151 VVAPATADLMAKMANGHADDLASAILLAANRPILLAPAMNPLMWNNAATRRNVAQLVRDGVHMVGPNAGEMAEANEAGTG 230
92115683  153 VVAPATADLMAKMAHGLASDLATAILLAADKPILLAPAMNPLMWNNPATRRNVAQLARDGVAMIGPNAGKMAEAGEAGVG 232
75674242  152 VVAPATADLMAKMANGLANDLASAILLASDRPVLLAPAMNPLMWNNPATRRNVARLARDGVAMIGPDAGEMAEAGEAGVG 231
49473718  139 ILAPATANRIAKIATGIGEDLADCVLLAARCPLLLAPAMNPAMWTHPTTVRNLAQLCADGVHIIGPEIGKMAERDETGPG 218
163867342 140 ILAPATANRIAKIAHGIGDDLADCVLLAARCPLLIAPAMNPAMWAHPATVRNVAQLRADGVHIIGPEIGNMAERDETGYG 219
209883642 147 VVAPATADLMAKMAQGLADDLASAILLATDKPVLLAPAMNPAMWNNAATKRNVAQLARDGRTFVGPNRGEMAEANEAGIG 226
229220679 151 VVAPATADLMAKMANGHADDLASAILLATNRKVLLAPAMNPLMWNNAATRRNVAQLQRDGVVLIGPNSGEMAEAGEAGIG 230
86747748  241 RMAEPVEIAAAAQALLAPP--SPRPLLGRRVLITAGPTHEPIDPVRYIANRSSGKQGYAIAAAAAAAGAEVVLISGPVDL 318
146337250 232 RMAEPTEIADAVVAMLKPP--APRPLAGRRVLITAGPTHEPIDPVRYIANRSSGKQGFAIAAAAQAAGADVRLIAGPVEL 309
148251705 232 RMAEPTEIADAVVAMLKPP--TPRPLAGRRVLITAGPTHEAIDPVRYIANRSSGKQGFAIAAAAQAAGADVRLIAGPVEL 309
90421904  231 RMAEPIEIAAAAQAFLRPQ--QAQPLTGCKLLITAGPTHEPIDPVRYIANRSSGKQGFALAAAAATAGAEVTLISGPVDL 308
92115683  233 RMAEPTEIATAAARILGPA--RPQPLEGKRVLVTAGPTREPIDPVRYIANRSSGKQGFAIAAAAQAAGAEVTLISGPVDL 310
75674242  232 RMAEPVAIAAAAARMLGPPqtQAQPLKGRRVLITAGPTREAIDPVRYIANRSSGKQGFAIAAAAQAAGAEVTLISGPVDL 311
49473718  219 RLSEPLTIVAAAEALLRV---QEKPLSGRHFIVTSGPTHEPIDPVRYLANRSSGKQGHAIATALAHLGAKVTLICGPVDL 295
163867342 220 RMSEPLTIVAAIEALLDV---REKPLSGRHFIVTSGPTHEPIDPVRYLANRSSGKQGHAIATALAHLGAKVTLICGPVNL 296
209883642 227 RMAEPLEIAAGALTLLQPA--QTQILKGRRVLITAGPTHEPIDPVRYIANRSSGKQGYAIAVAAAAAGADVVLISGPVNL 304
229220679 231 RMSEALEIAAAAERLLRPP--VPRPLAGKRVLITAGPTHEPIDPVRYIANRSSGKQGFAIAAAAQAAGAEVILVSGPVDL 308
86747748  319 RAPDGVTLTRVESARDMLDAVEAALPADIAIFAAAVADWRVASEGGQKIKKGEGGPPP-LQLTENPDILATVAKLGDDRP 397
146337250 310 ADPKGVKVTHVESARQMLEAVEAELPADVAIFAAAVADWRVASEGGQKLKKTDQAIPP-LQLVENPDILATISKLKEKRP 388
148251705 310 SDPKGVRVTHVESARQMLDAVEAELPADVAIFAAAVADWRVANEGGQKLKKTDTAIPP-LTLVENPDILATISKLKERRP 388
90421904  309 HDPAGVKVIRVESAREMLEAVDAALPVDVAIFAAAVADWRVADQGAQKLKKGSAGVPP-LQLVENPDILATISKRAENRP 387
92115683  311 DDPAGVTVAHVESAREMLAAVEAALPADIAIFTAAVADWRVAHEGAQKLKKTAAGMPP-LQLVENPDILATISKLRDTRP 389
75674242  312 DDPPGVTVAHVESARQMLAAVEAALPSDIAIFTAAVADWRVAHAGAQKLKKTEAGVPP-LQLIENPDILATISNLRDERP 390
49473718  296 ADPQEVKTIHVETACQMLQAVQAALPADGALFVAAVCDWRSQTQSLHKIKKSANKTPLsLPMLENPDILATIGH-ASNRP 374
163867342 297 ADPQEVKTIHVETAQQMLQAVQESLPADGAIFVAAVCDWRSQTQSLHKIKKNAHKTPPsLHMVENPDILATTGH-APNRP 375
209883642 305 PDPKGVKTIRVESAQEMLAAVEAALPTEVAIFAAAVADWRVAQAGAQKIKKGKDGAPA-LELVENPDILATIAKRATGRP 383
229220679 309 GDPQGVTVKHVESARQMLEQVQAALPADIAIFAAAVADWRVANEGEQKLKKTSAGMPP-LQLVENPDILATIAKLTDKRP 387
86747748  398 PLVIGFAAETENLLANARSKLARKGCDWIVANDVS---AAGGVMGGDRNTVHLLTK----SADTVDVESWPLMTKDDVAT 470
146337250 389 GLVIGFAAETEHLIDNAKAKFARKGCDWIVANDVS---PATGVMGGDRNTVHLLTK----DADGVHVASWPIMTKDEVAN 461
148251705 389 GLVIGFAAETEHLIDNAKAKFARKGCDWIVANDVS---PATGVMGGDRNTVHLLTK----DTEGVHVASWPIMTKDEVAT 461
90421904  388 PLVIGFAAETEHLLDNARAKLARKGCDWIVANDVT---PATGVMGGDRNTIHLLTR----AGDAIAIDSWPVMSKDQVAT 460
92115683  390 PLVIGFAAETEHLIDNARAKFARKGCDWMVANDVS---PGTGVMGGDRNTVHLLTRd--gVGDEIKAESFPVMTKEDVAA 464
75674242  391 PLVIGFAAETEHLIGNAKAKFARKGCDWMIANDVS---PGTGVMGGDRNTVHLLTRg---EDGEIRTESFPVMTKEEVAA 464
49473718  375 PLVIGFAAETCDFIANAQKKCAEKGANFILANNISl-pDGTNVMGADTNQVWLVSK--------ENVEQWPHMSKQQIAE 445
163867342 376 SLVIGFAAETCDIIANAQKKCVEKGADFILANDISlqqDGTSVMGADTNQVYLVSK--------EKVEQWPPMRKQHVAQ 447
209883642 384 PLVIGFAAETEHVAENARAKLARKGCDWIVANDVS---PATGIMGGDSNAVQIFIK------DQEAPEAWPAMSKTDVAA 454
229220679 388 PLVIGFAAETEHLIDNAKTKLARKGCDWIVANDVS---PATGVMGGDRNTVHLISRkngeKNGEIAVDSWPAMTKEQVAT 464
86747748  471 ALVARIARELe----VHQS 485
146337250 462 ALVAEIARTV-----GQSA 475
148251705 462 TLVAEIARTI-----GPAA 475
90421904  461 ALIARISKAVr----TTES 475
92115683  465 MLIERIVSTVt----DQPT 479
75674242  465 MLIERIISALp----GPAA 479
49473718  446 KLANIVVSFFc----SSSN 460
163867342 448 KLANIIVSFFtpqtpTPHK 466
209883642 455 RLVARIADTFsssteSTPA 473
229220679 465 ELIAHIVKSVigkslEPAS 483
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap