Conserved Protein Domain Family
PRK13974

?
PRK13974: PRK13974 
dTMP kinase
Statistics
?
PSSM-Id: 172477
View PSSM: PRK13974
Aligned: 15 rows
Threshold Bit Score: 343.182
Threshold Setting Gi: 72383332
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
33239604    1 MKGIFLVLEGIDGCGKSTQIEHLAQWLPLSGLMPSAAKLFITREPGGTRLGKSLRQLLLGTSpTDESPKPLTELLLYAAD 80 
126695487   1 MKGKFIVIEGIDGCGKTTQIDELSKWLPISGLLKKESKLITTREPGGSLLGKKLRRLILDNN-ENNKPSSLAELLLYSAD 79 
124024915   1 MKGKFIVFEGIDGSGKTTQINQLSKWLISTDLIPENNKLVITREPGGTQLGKSIRSLLLDTS-IEKSPDSITELLLYAAD 79 
124024337   1 MSGRLLVLEGIDGCGKTTQLRHLANWLPRSGLMPEGARLHLTREPGGTALGMALRKLVLHPP-GDASPEPLAELLLYAAD 79 
123967684   1 MKGKFIVIEGIDGCGKTTQIDELSKWLPNSGLIKKGSKLITTREPGGSLLGKKLRGLILDNN-KNNKPSSLAELLLYSAD 79 
78213888    1 MTGRFIVLEGIDGCGKTTQIQHLLEWLPNSGLMPKGAAVVCTREPGGTPLGRSIRELLLHTS-DQEAPAPTAELMLYAAD 79 
78183894    1 MTGRFIVLDGIDGCGKSTQIRHLAQWLPASGLMPSTAQLICTREPGGTPLGQSIRELLLHTE-ADQVPSVTAELLLYAAD 79 
33866768    1 MSGRFIVLDGIDGCGKSTQLDHLLGWLPGSGLMPAGAELISTREPGGTPLGRSVRELLLHTR-AEQAPAPTAELLLYAAD 79 
33864255    1 MSGRFLVLEGIDGCGKTTQLRHLANWLPRSGLMPEGARLHLTREPGGTALGIALRKLVLHPP-GDASPEPLAELLLYAAD 79 
159902685   1 MKGHFIVLEGIDGCGKSTQISHISKWLPQSGLMPKNANLYITREPGGTTLGKSLRDLLLHEH-ETNVPAPLTELLLYAAD 79 
33239604   81 RAQHVSQVIQPKINNGDWVISDRFSSSTLAYQGFGRRLDKSLIKELENIATQGITPDLTFLLEIPVSESIKRRENTRKDR 160
126695487  80 RAEHVSKIILPALNNNDWVISDRFSDSTLAYQGYGRNINLEIIKNIESIVCQGASPDLTFFLEISPEESIFRRKNEIPDR 159
124024915  80 RSQHVNEIIRPTLDQGDWVISDRFCGSTLAYQGYGRKLDITLIKDLEAIATQGIAPDITFLLDIPIEESIRRRRNRKDDR 159
124024337  80 RAQHVAQLIRPALEQGHWVLSDRFSGSTLAYQGYGRELDLDLIQQLEQIATAGLVPDLTFWLELSVEESLVRRDARSNDR 159
123967684  80 RAEHVSKIISPALNNNDWVISDRFSDSTLAYQGYGRNINLEIIKNIESIVCQGASPDLTFFLEISPEESIFRRKNEIPDR 159
78213888   80 RAQHVETLIRPALERGDWVISDRFSGSTLAYQGYGRGLDRDLIQRLEQIATAGLQPDITLWLRLSVQESLQRRLGDKEDR 159
78183894   80 RAQHVDTVIRPALLRGDWVLSDRFAGSTLAYQGYGRGLDRQLITRLESIATTGLEPDLTAWLMVPVEVSLQRRHGEKEDR 159
33866768   80 RAQHVERLILPTLERGDWVISDRFSGSTMAYQGYGRGLDRQLIDQLERIATAGVQPDLTLWLTLPLEESLRRRQGDQADR 159
33864255   80 RAQHVAQLIRPALEQGHWVLSDRFSGSTLAYQGYGRELDLDLIQQLEQIATAGLVPDLTFWLELPVEESLLRRDARSNDR 159
159902685  80 RAEHIHSLIQPKLDKGDWVISDRFSGSTLAYQGFGRGLDINLIRRLDAIARQGLVPEITIFLKISVLTSMRRRAKKSADR 159
33239604  161 IESEGEIFLKRVSDGFSYIAKNDNWLVIPANQKKDIVSKQIENKLINYFQNIS 213
126695487 160 IESEGIRFLERVNEGFKLIAKQKNWKVISASQNIKTISNQIKETLLNNFSNAK 212
124024915 160 IEKEGREFLSNVSLGFQALSEDSHWKKISAIDSKEKIISEIKSEIKKLIKNK- 211
124024337 160 IEAEGVDFLTRVATGFAVLARERSWVPLQADQQVESVSSALESQLKHHFGPLQ 212
123967684 160 IESEGIRFLEKVNEGFKLIAKQKNWKVISASQNIQTISNQIKETLLNNFSNNK 212
78213888  160 IEAEGAAFLERVAQGFAQLAEHRSWCAVAADQSASAVRAALERQLQEHLA--- 209
78183894  160 IEAEGRAFLRRVADGFAVLAEQRNWSQIDAQQSVSKLSQVLEQTLRETLQ--- 209
33866768  160 IEAEGQVFLQRVIDGFAAIAEQRQWSAIAADRPPEAVSRALERELMDRLG--- 209
33864255  160 IEAEGVDFLTRVATGFAVLARERSWVPLQADQQVESVSSALESQLKHHFGPLQ 212
159902685 160 MEAEGEGFLKKVASGFSRIANEEHWITIEGEQDQALVSDEIKLAITNKLKNYI 212
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap