Conserved Protein Domain Family
PRK13972

?
PRK13972: PRK13972 
GSH-dependent disulfide bond oxidoreductase; Provisional
Statistics
?
PSSM-Id: 172475
View PSSM: PRK13972
Aligned: 37 rows
Threshold Bit Score: 425.643
Threshold Setting Gi: 218548243
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
117624492   1 MIDLYFAPTPNGHKITLFLEEAGLDYRLIKVDLGKGGQFRPEFLRISPNNKIPAIVDHSPADGGEPLSLFESGAILLYLA 80 
26248691    1 MIDLYFAPTPNGHKITLFLEEAGLDYRLIKVDLGKGGQFRPEFLRISPNNKIPAIVDHSPADGGEPLSLFESGAILLYLA 80 
15832440    1 MIDLYFAPTPNGHKITLFLEEAGLDYRLIKVDLGKGGQFRPEFLLISPNNKIPAIVDHSPADGGEPLSLFESGAILLYLA 80 
15802849    1 MIDLYFAPTPNGHKITLFLEEAGLDYRLIKVDLGKGGQFRPEFLLISPNNKIPAIVDHSPADGGEPLSLFESGAILLYLA 80 
209398828   1 MIDLYFAPTPNGHKITLFLEEAGLDYRLIKVDLGKGGQFRPEFLLISPNNKIPAIVDHSPADGGEPLSLFESGAILLYLA 80 
218700776   1 MIDLYFAPTPNGHKITLFLEEAGLDYRLIKVDLGKGGQFRPEFLHISPNNKIPAIVDHSPADGGEPLSLFESGAILLYLA 80 
218690462   1 MIDLYFAPTPNGHKITLFLEEAGLDYRLIKVDLGKGGQFRPEFLRISPNNKIPAIVDHSPADGGEPLSLFESGAILLYLA 80 
215487515   1 MIDLYFAPTPNGHKITLFLEEAGLDYRLIKVDLGKGGQFRPEFLRISPNNKIPAIVDHSPADGGEPLSLFESGAILLYLA 80 
218705832   1 MIDLYFAPTPNGHKITLFLEEAGLDYRLIKVDLGKGGQFRPEFLHISPNNKIPAIVDHSPADGGEPLSLFESGAILLYLA 80 
254794195   1 MIDLYFAPTPNGHKITLFLEEAGLDYRLIKVDLGKGGQFRPEFLLISPNNKIPAIVDHSPADGGEPLSLFESGAILLYLA 80 
117624492  81 EKTGLFLSHETRERAVTLQWLFWQVGGLGPMLGQNHHFNHAAPQTIPYAIERYQVETQRLYHVLNKRLENSPWLGGENYS 160
26248691   81 EKTGLFLSHETRERAVTLQWLFWQVGGLGPMLGQNHHFNHATPQTIPYAIERYQVETQRLYHVLNKRLENSPWLGGENYS 160
15832440   81 EKTGLFLSHETRERAATLQWLFWQVGGLGPMLGQNHHFNHAAPQTIPYAIERYQVETQRLYHVLNKRLENSPWLGGENYS 160
15802849   81 EKTGLFLSHETRERAATLQWLFWQVGGLGPMLGQNHHFNHAAPQTIPYAIERYQVETQRLYHVLNKRLENSPWLGGENYS 160
209398828  81 EKTGLFLSHETRERAATLQWLFWQVGGLGPMLGQNHHFNHAAPQTIPYAIERYQVETQRLYHVLNKRLENSPWLGGENYS 160
218700776  81 EKTGLFLSHETRERAATLQWLFWQVGGLGPMLGQNHHFNHAAPQTIPYAIERYQVETQRLYHVLNKRLENSPWLGGENYS 160
218690462  81 EKTGLFLSHETRERAVTLQWLFWQVGGLGPMLGQNHHFNHAAPQTIPYAIERYQVETQRLYHVLNKRLENSPWLGGENYS 160
215487515  81 EKTGLFLSHETRERAVTLQWLFWQVGGLGPMLGQNHHFNHAAPQTIPYAIERYQVETQRLYHVLNKRLENSPWLGGENYS 160
218705832  81 EKTGLFLSHETRERAATLQWLFWQVGGLGPMLGQNHHFNHAAPQTIPYAIERYQVETQRLYHVLNKRLEYSPWLGGENYS 160
254794195  81 EKTGLFLSHETRERAATLQWLFWQVGGLGPMLGQNHHFNHAAPQTIPYAIERYQVETQRLYHVLNKRLENSPWLGGENYS 160
117624492 161 IADIACWPWVNAWTRQRIDLAMYPAVKNWHERIRSRPATGLALLKAQHGDERSDS 215
26248691  161 IADIACWPWVNAWTRQRIDLAMYPAVKNWHERIRSRPATGQALLKAQHGDERSDS 215
15832440  161 IADIACWPWVNAWTRQRIDLAMYPAVKNWHERIRSRPATGQALLKAQLGDERSDS 215
15802849  161 IADIACWPWVNAWTRQRIDLAMYPAVKNWHERIRSRPATGQALLKAQLGDERSDS 215
209398828 161 IADIACWPWVNAWTRQRIDLAMYPAVKNWHERIRSRPATGQALLKAQLGDERSDS 215
218700776 161 IADIACWPWVNAWTRQRIDLAMYPAVKNWHERIRSRPATGQALLKAQHGDERSDS 215
218690462 161 IADIACWPWVNAWTRQRIDLAMYPAVKNWHERIRSRPATGQALLKAQHGDERSDS 215
215487515 161 IADIACWPWVNAWTRQRIDLAMYPAVKNWHERIRSRPATGQALLKAQHGDERSDS 215
218705832 161 IADIACWPWVNAWTRQRIDLAMYPAVKNWHERIRSRPATGQALLKAQLGDERSDS 215
254794195 161 IADIACWPWVNAWTRQRIDLAMYPAVKNWHERIRSRPATGQALLKAQLGDERSDS 215
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap