Conserved Protein Domain Family
PRK13970

?
PRK13970: PRK13970 
4-hydroxyproline epimerase
Statistics
?
PSSM-Id: 172473
View PSSM: PRK13970
Aligned: 18 rows
Threshold Bit Score: 606.634
Threshold Setting Gi: 126446932
Created: 9-Dec-2010
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
134293388  10 MMKRIQIIDSHTGGEPTRLVVSGFPSLGNGTMAERRDVLAREHDRYRTACILEPRGSDVLVGALLCEPVSPDAAAGVIFF 89 
124382300  10 DMKHIHIIDSHTGGEPTRVVVSGFPALGGGTMAERLAVLAREHDRYRAACILEPRGSDVLVGALLCEPVSAGAAAGVIFF 89 
126456094   1 -MKHIHIIDSHTGGEPTRVVVSGFPALGGGTMAERLAVLAREHDRYRAACILEPRGSDVLVGALLCEPVSAGAAAGVIFF 79 
126446932   1 -MKHIHIIDSHTGGEPTRVVVSGFPALGGGTMAERLAVLAREHDRYRAACILEPRGSDVLVGALLCEPVSAGAAAGVIFF 79 
126444817  10 DMKHIHIIDSHTGGEPTRVVVSGFPALGGGTMAERLAVLAREHDRYRAACILEPRGSDVLVGALLCEPVSAGAAAGVIFF 89 
107026574  49 MMKRIQIIDSHTGGEPTRLVVSGFPSLGRGTMAERRDVLAREHDRYRTACILEPRGSDVMVGALLCDPVAPDAAAGVIFF 128
76817590   10 DMKHIHIIDSHTGGEPTRVVVSGFPALGGGTMAERLAVLAREHDRYRAACILEPRGSDVLVGALLCEPVSAGAAAGVIFF 89 
53721367    1 -MKHIHIIDSHTGGEPTRVVVSGFPALGGGTMAERLAVLAREHDRYRAACILEPRGSDVLVGALLCEPVSAGAAAGVIFF 79 
53716979   10 DMKHIHIIDSHTGGEPTRVVVSGFPALGGGTMAERLAVLAREHDRYRAACILEPRGSDVLVGALLCEPVSAGAAAGVIFF 89 
170735763   1 -MKRIQIIDSHTGGEPTRLVVSGFPSLGSGTMAERRDVLAREHDRYRTACILEPRGSDVMVGALLCDPVAPDAAAGVIFF 79 
134293388  90 NNSGYLGMCGHGTIGVVRTLHHMGRIGPGVHLIETPVGTVEATLHDDLSVSVRNVLAYRHAKAVEVDVPGYGPVKGDIAW 169
124382300  90 NNAGYLGMCGHGTIGLVRTLHHMGRIGPGVHRIETPVGDVEATLHDDLSVSVRNVLVYRHAKDVVVDVPGHGAVTGDVAW 169
126456094  80 NNAGYLGMCGHGTIGLVRTLHHMGRIGPGVHRIETPVGDVEATLHDDLSVSVRNVLAYRHAKDVVVDVPGHGAVTGDVAW 159
126446932  80 NNAGYLGMCGHGTIGLVRTLHHMGRIGPGVHRIETPVGDVEATLHDDLSVSVRNVLVYRHAKDVVVDVPGHGAVTGDVAW 159
126444817  90 NNAGYLGMCGHGTIGLVRTLHHMGRIGPGVHRIETPVGDVEATLHDDLSVSVRNVLAYRHAKDVVVDVPGHGAVTGDVAW 169
107026574 129 NNSGYLGMCGHGTIGVVRTLHHMGRIEPGVHRIETPVGTVEATLHDDLSVSVRNVPAYRHAQGVVLDVPGYGPVKGDIAW 208
76817590   90 NNAGYLGMCGHGTIGLVRTLHHMGRIGPGVHRIETPVGDVEATLHDDLSVSVRNVLAYRHAKDVVVDVPGHGAVTGDVAW 169
53721367   80 NNAGYLGMCGHGTIGLVRTLHHMGRIGPGVHRIETPVGDVEATLHDDLSVSVRNVLAYRHAKDVVVDVPGHGAVTGDVAW 159
53716979   90 NNAGYLGMCGHGTIGLVRTLHHMGRIGPGVHRIETPVGDVEATLHDDLSVSVRNVLVYRHAKDVVVDVPGHGAVTGDVAW 169
170735763  80 NNSGYLGMCGHGTIGVVRTLHHMGRIAPGVHRIETPVGTVEATLHDDLSVSVRNVPAYRHAQGVALDVPGYGPVKGDIAW 159
134293388 170 GGNWFFLISEHGQRVAGDNVAALTAYSSAVRAGLERAGITGANGGEIDHIELFADDPEHDSRSFVLCPGHAYDRSPCGTG 249
124382300 170 GGNWFFLVSDHGQRVAGENVAALAAYASAVRAALERAGVTGRDGAPIDHIELFADDPEYDSRSFVLCPGHAYDRSPCGTG 249
126456094 160 GGNWFFLVSDHGQRVAGENVAALAAYASAVRAALERAGVTGRDGAPIDHIELFADDPEYDSRSFVLCPGHAYDRSPCGTG 239
126446932 160 GGNWFFLVSDHGQRVAGENVAALAAYASAVRAALERAGVTGRDGAPIDHIELFADDPEYDSRSFVLCPGHAYDRSPCGTG 239
126444817 170 GGNWFFLVSDHGQRVAGENVAALAAYASAVRAALERAGVTGRDGAPIDHIELFADDPEYDSRSFVLCPGHAYDRSPCGTG 249
107026574 209 GGNWFFLISDHGQRVAGDNVAALTAYASAVREGLERAGITGANGGEIDHIELFADDPEHDSRSFVLCPGLAYDRSPCGTG 288
76817590  170 GGNWFFLVSDHGQRVAGENVAALAAYASAVRAALERAGVTGRDGAPIDHIELFADDPEYDSRSFVLCPGHAYDRSPCGTG 249
53721367  160 GGNWFFLVSDHGQRVAGENVAALAAYASAVRAALERAGVTGRDGAPIDHIELFADDPEYDSRSFVLCPGHAYDRSPCGTG 239
53716979  170 GGNWFFLVSDHGQRVAGENVAALAAYASAVRAALERAGVTGRDGAPIDHIELFADDPEYDSRSFVLCPGHAYDRSPCGTG 249
170735763 160 GGNWFFLISDHGQRVAGDNVAALTAYASAVREGLERAGITGANGGEIDHIELFADDPEHDSRSFVLCPGLAYDRSPCGTG 239
134293388 250 TSAKLACLAADGKLEPGVVWRQASVIGSVFHASYALADGGIVPTIRGSAHLSAEATLLIDEDDPFGWGIVS 320
124382300 250 TSAKLACLAADGKLVAGVTWRQASVIGSVFSASYAAAEGGVVPTIRGSAHLSAEATLVIEDDDPFGWGIAS 320
126456094 240 TSAKLACLAADGKLAAGVTWRQASVIGSVFSASYAAAEGGVVPTIRGSAHLSAEATLVIEDDDPFGWGIAS 310
126446932 240 TSAKLACLAADGKLVAGVTWRQASVIGSVFSASYAAAEGGVVPTIRGSAHLSAEATLVIEDDDPFGWGIAS 310
126444817 250 TSAKLACLAADGKLAAGVTWRQASVIGSVFSASYAAAEGGVVPTIRGSAHLSAEATLVIEDDDPFGWGIAS 320
107026574 289 TSAKLACLAADGKLAPGVVWRQASVIGSVFHASYELADGGIVPTIRGSAHLSAEATLLIDEDDPFGWGIGS 359
76817590  250 TSAKLACLAADGKLAAGVTWRQASVIGSVFSASYAAAEGGVVPTIRGSAHLSAEATLVIEDDDPFGWGIAS 320
53721367  240 TSAKLACLAADGKLAAGVTWRQASVIGSVFSASYAAAEGGVVPTIRGSAHLSAEATLVIEDDDPFGWGIAS 310
53716979  250 TSAKLACLAADGKLVAGVTWRQASVIGSVFSASYAAAEGGVVPTIRGSAHLSAEATLVIEDDDPFGWGIAS 320
170735763 240 TSAKLACLAADGKLAPGAVWRQASVIGSVFHASYELADGGIVPTIRGSAHLSAEATLLIDEDDPFGWGIGS 310
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap