Conserved Protein Domain Family
nrdF1

?
PRK13967: nrdF1 
ribonucleotide-diphosphate reductase subunit beta; Provisional
Statistics
?
PSSM-Id: 140023
View PSSM: PRK13967
Aligned: 7 rows
Threshold Bit Score: 654.875
Threshold Setting Gi: 57116932
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
57116932    1 MTGKLVERVHAINWNRLLDAKDLQVWERLTGNFWLPEKIPLSNDLASWQTLSSTEQQTTIRVFTGLTLLDTAQATVGAVA 80 
15841457    1 MTGKLVERVHAINWNRLLDAKDLQVWERLTGNFWLPEKIPLSNDLASWQTLSSTEQQTTIRVFTGLTLLDTAQATVGAVA 80 
31793160    1 MTGKRVERVHAINWNRLLDAKDLQVWERLTGNFWLPEKIPLSNDLASWQTLSSTEQQTTIRVFTGLTLLDTAQATVGAVA 80 
148661790   1 MTGKLVERVHAINWNRLLDAKDLQVWERLTGNFWLPEKIPLSNDLASWQTLSSTEQQTTIRVFTGLTLLDTAQATVGAVA 80 
148823195   1 MTGKLVERVHAINWNRLLDAKDLQVWERLTGNFWLPEKIPLSNDLASWQTLSSTEQQTTIRVFTGLTLLDTAQATVGAVA 80 
224990358   1 MTGKRVERVHAINWNRLLDAKDLQVWERLTGNFWLPEKIPLSNDLASWQTLSSTEQQTTIRVFTGLTLLDTAQATVGAVA 80 
253798971   1 MTGKLVERVHAINWNRLLDAKDLQVWERLTGNFWLPEKIPLSNDLASWQTLSSTEQQTTIRVFTGLTLLDTAQATVGAVA 80 
57116932   81 MIDDAVTPHEEAVLTNMAFMESVHAKSYSSIFSTLCSTKQIDDAFDWSEQNPYLQRKAQIIVDYYRGDDALKRKASSVML 160
15841457   81 MIDDAVTPHEEAVLTNMAFMESVHAKSYSSIFSTLCSTKQIDDAFDWSEQNPYLQRKAQIIVDYYRGDDALKRKASSVML 160
31793160   81 MIDDAVTPHEEAVLTNMAFMESVHAKSYSSIFSTLCSTKQIDDAFDWSEQNPYLQRKAQIIVDYYRGDDALKRKASSVML 160
148661790  81 MIDDAVTPHEEAVLTNMAFMESVHAKSYSSIFSTLCSTKQIDDAFDWSEQNPYLQRKAQIIVDYYRGDDALKRKASSVML 160
148823195  81 MIDDAVTPHEEAVLTNMAFMESVHAKSYSSIFSTLCSTKQIDDAFDWSEQNPYLQRKAQIIVDYYRGDDALKRKASSVML 160
224990358  81 MIDDAVTPHEEAVLTNMAFMESVHAKSYSSIFSTLCSTKQIDDAFDWSEQNPYLQRKAQIIVDYYRGDDALKRKASSVML 160
253798971  81 MIDDAVTPHEEAVLTNMAFMESVHAKSYSSIFSTLCSTKQIDDAFDWSEQNPYLQRKAQIIVDYYRGDDALKRKASSVML 160
57116932  161 ESFLFYSGFYLPMYWSSRGKLTNTADLIRLIIRDEAVHGYYIGYKCQRGLADLTDAERADHREYTCELLHTLYANEIDYA 240
15841457  161 ESFLFYSGFYLPMYWSSRGKLTNTADLIRLIIRDEAVHGYYIGYKCQRGLADLTDAERADHREYTCELLHTLYANEIDYA 240
31793160  161 ESFLFYSGFYLPMYWSSRGKLTNTADLIRLIIRDEAVHGYYIGYKCQRGLADLTDAERADHREYTCELLHTLYANEIDYA 240
148661790 161 ESFLFYSGFYLPMYWSSRGKLTNTADLIRLIIRDEAVHGYYIGYKCQRGLADLTDAERADHREYTCELLHTLYANEIDYA 240
148823195 161 ESFLFYSGFYLPMYWSSRGKLTNTADLIRLIIRDEAVHGYYIGYKCQRGLADLTDAERADHREYTCELLHTLYANEIDYA 240
224990358 161 ESFLFYSGFYLPMYWSSRGKLTNTADLIRLIIRDEAVHGYYIGYKCQRGLADLTDAERADHREYTCELLHTLYANEIDYA 240
253798971 161 ESFLFYSGFYLPMYWSSRGKLTNTADLIRLIIRDEAVHGYYIGYKCQRGLADLTDAERADHREYTCELLHTLYANEIDYA 240
57116932  241 HDLYDELGWTDDVLPYMRYNANKALANLGYQPAFDRDTCQVNPAVRAALDPGAGENHDFFSGSGSSYVMGTHQPTTDTDW 320
15841457  241 HDLYDELGWTDDVLPYMRYNANKALANLGYQPAFDRDTCQVNPAVRAALDPGAGENHDFFSGSGSSYVMGTHQPTTDTDW 320
31793160  241 HDLYDELGWTDDVLPYMRYNANKALANLGYQPAFDRDTCQVNPAVRAALDPGAGENHDFFSGSGSSYVMGTHQPTTDTDW 320
148661790 241 HDLYDELGWTDDVLPYMRYNANKALANLGYQPAFDRDTCQVNPAVRAALDPGAGENHDFFSGSGSSYVMGTHQPTTDTDW 320
148823195 241 HDLYDELGWTDDVLPYMRYNANKALANLGYQPAFDRDTCQVNPAVRAALDPGAGENHDFFSGSGSSYVMGTHQPTTDTDW 320
224990358 241 HDLYDELGWTDDVLPYMRYNANKALANLGYQPAFDRDTCQVNPAVRAALDPGAGENHDFFSGSGSSYVMGTHQPTTDTDW 320
253798971 241 HDLYDELGWTDDVLPYMRYNANKALANLGYQPAFDRDTCQVNPAVRAALDPGAGENHDFFSGSGSSYVMGTHQPTTDTDW 320
57116932  321 DF 322
15841457  321 DF 322
31793160  321 DF 322
148661790 321 DF 322
148823195 321 DF 322
224990358 321 DF 322
253798971 321 DF 322
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap