Conserved Protein Domain Family
nrdF2

?
PRK13966: nrdF2 
ribonucleotide-diphosphate reductase subunit beta; Provisional
Statistics
?
PSSM-Id: 140022
View PSSM: PRK13966
Aligned: 9 rows
Threshold Bit Score: 600.554
Threshold Setting Gi: 148824239
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
148824239   1 MTGNAKLIDRVSAINWNRLQDEKDAEVWDRLTGNFWLPEKVPVSNDIPSWGTLTAGEKQLTMRVFTGLTMLDTIQGTVGA 80 
148662901   1 MTGNAKLIDRVSAINWNRLQDEKDAEVWDRLTGNFWLPEKVPVSNDIPSWGTLTAGEKQLTMRVFTGLTMLDTIQGTVGA 80 
118469934   1 MSDGIKLIDRVSAINWNRLQDEKDAEVWHRLTGNFWLPEKVPVSNDIQSWHTLTDNEKQLTMRVFTGLTLLDTIQGTVGA 80 
118469232   1 MSDGIKLIDRVSAINWNRLQDEKDAEVWHRLTGNFWLPEKVPVSNDIQSWHTLTDNEKQLTMRVFTGLTLLDTIQGTVGA 80 
31794226    1 MTGNAKLIDRVSAINWNRLQDEKDAEVWDRLTGNFWLPEKVPVSNDIPSWGTLTAGEKQLTMRVFTGLTMLDTIQGTVGA 80 
15842613    1 MTGNAKLIDRVSAINWNRLQDEKDAEVWDRLTGNFWLPEKVPVSNDIPSWGTLTAGEKQLTMRVFTGLTMLDTIQGTVGA 80 
57117051    1 MTGNAKLIDRVSAINWNRLQDEKDAEVWDRLTGNFWLPEKVPVSNDIPSWGTLTAGEKQLTMRVFTGLTMLDTIQGTVGA 80 
224991424   1 MTGNAKLIDRVSAINWNRLQDEKDAEVWDRLTGNFWLPEKVPVSNDIPSWGTLTAGEKQLTMRVFTGLTMLDTIQGTVGA 80 
253797854   1 MTGNAKLIDRVSAINWNRLQDEKDAEVWDRLTGNFWLPEKVPVSNDIPSWGTLTAGEKQLTMRVFTGLTMLDTIQGTVGA 80 
148824239  81 VSLIPDALTPHEEAVLTNIAFMESVHAKSYSQIFSTLCSTAEIDDAFRWSEENRNLQRKAEIVLQYYRGDEPLKRKVAST 160
148662901  81 VSLIPDALTPHEEAVLTNIAFMESVHAKSYSQIFSTLCSTAEIDDAFRWSEENRNLQRKAEIVLQYYRGDEPLKRKVAST 160
118469934  81 VSLIPDAVTPHEEAVLTNIAFMESVHAKSYSNIFSTLCSTAEIDDAFRWSEENPNLQRKAAIVMQYYRGDEPLKRKVAST 160
118469232  81 VSLIPDAVTPHEEAVLTNIAFMESVHAKSYSNIFSTLCSTAEIDDAFRWSEENPNLQRKAAIVMQYYRGDEPLKRKVAST 160
31794226   81 VSLIPDALTPHEEAVLTNIAFMESVHAKSYSQIFSTLCSTAEIDDAFRWSEENRNLQRKAEIVLQYYRGDEPLKRKVAST 160
15842613   81 VSLIPDALTPHEEAVLTNIAFMESVHAKSYSQIFSTLCSTAEIDDAFRWSEENRNLQRKAEIVLQYYRGDEPLKRKVAST 160
57117051   81 VSLIPDALTPHEEAVLTNIAFMESVHAKSYSQIFSTLCSTAEIDDAFRWSEENRNLQRKAEIVLQYYRGDEPLKRKVAST 160
224991424  81 VSLIPDALTPHEEAVLTNIAFMESVHAKSYSQIFSTLCSTAEIDDAFRWSEENRNLQRKAEIVLQYYRGDEPLKRKVAST 160
253797854  81 VSLIPDALTPHEEAVLTNIAFMESVHAKSYSQIFSTLCSTAEIDDAFRWSEENRNLQRKAEIVLQYYRGDEPLKRKVAST 160
148824239 161 LLESFLFYSGFYLPMYWSSRAKLTNTADMIRLIIRDEAVHGYYIGYKFQRGLALVDDVTRAELKDYTYELLFELYDNEVE 240
148662901 161 LLESFLFYSGFYLPMYWSSRAKLTNTADMIRLIIRDEAVHGYYIGYKFQRGLALVDDVTRAELKDYTYELLFELYDNEVE 240
118469934 161 LLESFLFYSGFYLPMYWSSRAKLTNTADMIRLIIRDEAVHGYYIGYKYQRGLALVDEEKKQELKDYTYELLFELYDNEVE 240
118469232 161 LLESFLFYSGFYLPMYWSSRAKLTNTADMIRLIIRDEAVHGYYIGYKYQRGLALVDEEKKQELKDYTYELLFELYDNEVE 240
31794226  161 LLESFLFYSGFYLPMYWSSRAKLTNTADMIRLIIRDEAVHGYYIGYKFQRGLALVDDVTRAELKDYTYELLFELYDNEVE 240
15842613  161 LLESFLFYSGFYLPMYWSSRAKLTNTADMIRLIIRDEAVHGYYIGYKFQRGLALVDDVTRAELKDYTYELLFELYDNEVE 240
57117051  161 LLESFLFYSGFYLPMYWSSRAKLTNTADMIRLIIRDEAVHGYYIGYKFQRGLALVDDVTRAELKDYTYELLFELYDNEVE 240
224991424 161 LLESFLFYSGFYLPMYWSSRAKLTNTADMIRLIIRDEAVHGYYIGYKFQRGLALVDDVTRAELKDYTYELLFELYDNEVE 240
253797854 161 LLESFLFYSGFYLPMYWSSRAKLTNTADMIRLIIRDEAVHGYYIGYKFQRGLALVDDVTRAELKDYTYELLFELYDNEVE 240
148824239 241 YTQDLYDEVGLTEDVKKFLRYNANKALMNLGYEALFPRDETDVNPAILSALSPNADENHDFFSGSGSSYVIGKAVVTEDD 320
148662901 241 YTQDLYDEVGLTEDVKKFLRYNANKALMNLGYEALFPRDETDVNPAILSALSPNADENHDFFSGSGSSYVIGKAVVTEDD 320
118469934 241 YTQDLYDSVGLTEDVKKFLRYNANKALMNLGYEALFPRDETDVNPAILSALAPNADENHDFFSGSGSSYVIGKAVNTEDE 320
118469232 241 YTQDLYDSVGLTEDVKKFLRYNANKALMNLGYEALFPRDETDVNPAILSALAPNADENHDFFSGSGSSYVIGKAVNTEDE 320
31794226  241 YTQDLYDEVGLTEDVKKFLRYNANKALMNLGYEALFPRDETDVNPAILSALSPNADENHDFFSGSGSSYVIGKAVVTEDD 320
15842613  241 YTQDLYDEVGLTEDVKKFLRYNANKALMNLGYEALFPRDETDVNPAILSALSPNADENHDFFSGSGSSYVIGKAVVTEDD 320
57117051  241 YTQDLYDEVGLTEDVKKFLRYNANKALMNLGYEALFPRDETDVNPAILSALSPNADENHDFFSGSGSSYVIGKAVVTEDD 320
224991424 241 YTQDLYDEVGLTEDVKKFLRYNANKALMNLGYEALFPRDETDVNPAILSALSPNADENHDFFSGSGSSYVIGKAVVTEDD 320
253797854 241 YTQDLYDEVGLTEDVKKFLRYNANKALMNLGYEALFPRDETDVNPAILSALSPNADENHDFFSGSGSSYVIGKAVVTEDD 320
148824239 321 DWDF 324
148662901 321 DWDF 324
118469934 321 DWDF 324
118469232 321 DWDF 324
31794226  321 DWDF 324
15842613  321 DWDF 324
57117051  321 DWDF 324
224991424 321 DWDF 324
253797854 321 DWDF 324
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap