Conserved Protein Domain Family
PRK13957

?
PRK13957: PRK13957 
indole-3-glycerol-phosphate synthase; Provisional
Statistics
?
PSSM-Id: 140013
View PSSM: PRK13957
Aligned: 6 rows
Threshold Bit Score: 443.17
Threshold Setting Gi: 189910702
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
189910702   1 MNPILHKIVETKHSEIE-LSRGKTLPDRKIPIRDwksNLKTNSVSVIAECKKGSPSAGILRPDYHPVEIAKLYETSGAGA 79 
183220594   1 MNPILHKIVETKHSEIE-LSRGKTLPDRKIPIRDwksNLKTNSVSVIAECKKGSPSAGILRPDYHPVEIAKLYETSGAGA 79 
45658617    6 PHRVLREIISTKQNEIKkISAWDPLPHRGLSLRD---SLKSRTFSIIAECKRKSPSAGELRADYRPVQIAKTYEELGASA 82 
24213540    6 PHRVLREIISTKQNEIKkISAWDPLPHRGLSLRD---SLKSRTFSIIAECKRKSPSAGELRADYRPVQIAKTYEELGASA 82 
116328897   6 LHRVLREIIATKQNEIEkIRNWDPVPYQGLGLRE---SLKSRSFSIIAECKRKSPSAGEICADYDPVQIAKTYEALGASA 82 
116330496   6 LHRVLREIIATKQNEIEkIRNWDPVPYQGLGLRE---SLKSRSFSIIAECKRKSPSAGEICADYDPVQIAKTYEALGASA 82 
189910702  80 ISVLTDQSYFFGSLNDLESVANQVSLPVIRKDFILDPIQIDEAYAYGASAILLIVRILSPSLLKSLHEHANRLGLAVLVE 159
183220594  80 ISVLTDQSYFFGSLNDLESVANQVSLPVIRKDFILDPIQIDEAYAYGASAILLIVRILSPSLLKSLHEHANRLGLAVLVE 159
45658617   83 ISVLTDQNYFGGSLEDLKDVSSELKIPVLRKDFILDEIQIREARAFGASAILLIVRILTPEQIKSFLKLASSLGMDCLVE 162
24213540   83 ISVLTDQNYFGGSLEDLKDVSSELKIPVLRKDFILDEIQIREARAFGASAILLIVRILTPEQIKSFLKLASSLGMDCLVE 162
116328897  83 VSVLTDRDYFGGSLEDLKNVSSELKIPILRKDFILNEVQIREARAFGASAILLIVRILTPAQIKTFLKSASSFGMDSLVE 162
116330496  83 VSVLTDRDYFGGSLEDLKNVSSELKIPILRKDFILNEVQIREARAFGASAILLIVRILTPAQIKTFLKSASSFGMDSLVE 162
189910702 160 THNELEVNLALDAGANTIGINTRDLDTFQIHKNLIEEIAPKLDPSIIRVAESGIESYEDWQKYRGMIDSMLVGTFFMKSK 239
183220594 160 THNELEVNLALDAGANTIGINTRDLDTFQIHKNLIEEIAPKLDPSIIRVAESGIESYEDWQKYRGMIDSMLVGTFFMKSK 239
45658617  163 VHTSDEAKLALDCGAEIIGINTRDLDTFQIHQNLVEEVSAFLPPNIVKVGESGIKKRSDLDTFRKLVDAALIGTYFMEKQ 242
24213540  163 VHTSDEAKLALDCGAEIIGINTRDLDTFQIHQNLVEEVSAFLPPNIVKVGESGIKKRSDLDTFRKLVDAALIGTYFMEKQ 242
116328897 163 VHTPDEAKLALDCGAEIIGINTRDLDTFQIHQNLVEEVTAFLPRNVVKVGESGVGSRSDLDRFRKLVNAALIGTYFMEKS 242
116330496 163 VHTPDEAKLALDCGAEIIGINTRDLDTFQIHQNLVEEVTAFLPRNVVKVGESGVGSRSDLDRFRKLVNAALIGTYFMEKS 242
189910702 240 NIQHDFFSLL 249
183220594 240 NIQHDFFSLL 249
45658617  243 DIRKAWLNLF 252
24213540  243 DIRKAWLNLF 252
116328897 243 DIRKAWLELF 252
116330496 243 DIRKAWLELF 252
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap