Conserved Protein Domain Family
mscL

?
PRK13954: mscL 
large conductance mechanosensitive channel protein MscL
Statistics
?
PSSM-Id: 172460
View PSSM: PRK13954
Aligned: 20 rows
Threshold Bit Score: 137.683
Threshold Setting Gi: 27467948
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
222151253   3 LLKEFKEFAVKGNVLDLAVAVVIGAAFGKIVSSLVADVIMPIIGLIFGNTDFASSWAYKGIKYGVFIQSIVDFLIVAGAI 82 
73662719    1 MLKEFKEFALKGNVLDLAVAVVMGAAFNKIVTALVSYIIMPLIGLIFGTVDFAESWSFMGIKYGMFVQSIIDFIIIAFAL 80 
27467948    1 MLKEFKEFALKGNVLDLAIAVVMGAAFNKIVTSLVQYIIMPLIGKLFGSVNFAEDWSFWGIKYGLFIQSIIDFIIIAFAL 80 
57650352    1 MLKEFKEFALKGNVLDLAIAVVMGAAFNKIISSLVENIIMPLIGKIFGSVDFAKEWSFWGIKYGLFIQSVIDFIIIAFAL 80 
57866848    1 MLKEFKEFALKGNVLDLAIAVVMGAAFNKIVTSLVQYIIMPLIGKLFGSVNFAEDWSFWGIKYGLFIQSIIDFIIIAFAL 80 
70726561    1 MLKEFKEFALKGNVLDLAIAVVMGAAFNKIVTSLVTYIIMPLIGKIFGSVDFAKDWEFWGIKYGLFIQSIIDFIIVAIAL 80 
150393898   1 MLKEFKEFALKGNVLDLAIAVVMGAAFNKIISSLVENIIMPLIGKIFGSVDFAKEWSFWGIKYGLFIQSVIDFIIIAFAL 80 
151221472   1 MLKEFKEFALKGNVLDLAIAVVMGAAFNKIISSLVENIIMPLIGKIFGSVDFAKEWSFWGIKYGLFIQSVIDFIIIAFAL 80 
156979667   1 MLKEFKEFALKGNVLDLAIAVVMGAAFNKIISSLVENIIMPLIGKIFGSVDFAKEWSFWGIKYGLFIQSVIDFIIIAFAL 80 
289550865   9 MLKEFKEFALKGNVLDLAIAVVMGAAFNKIVTSLVTYIIMPLIGKIFGSVDFAKDWEFWGIKYGLFIQSIIDFLIVAFAL 88 
222151253  83 FLFIKLINKITRKSEVEEvEEAVEENTVLLTEIRDLLRSK 122
73662719   81 FIFVKIANTLMKKEEEEE----IEENTVLLTEIRDLLREK 116
27467948   81 FIFVKIANTVMKKEEKEE-E--VEENTVLLTEIRDLLKK- 116
57650352   81 FIFVKIANTLMKKEEAEE-EAVVEENVVLLTEIRDLLREK 119
57866848   81 FIFVKIANTVMKKEEKEE-E--VEENTVLLTEIRDLLKK- 116
70726561   81 FIFVKIANTLVKKEEPEE-E--IEENTVLLTEIRDLLRAK 117
150393898  81 FIFVKIANTLMKKEEAEE-EAVVEENVVLLTEIRDLLREK 119
151221472  81 FIFVKIANTLMKKEEAEE-EAVVEENVVLLTEIRDLLREK 119
156979667  81 FIFVKIANTLMKKEEAEE-EAVVEENVVLLTEIRDLLREK 119
289550865  89 FVFVKIANTLMKKEEPEE-T--IEENTVLLTEIRDLLREK 125
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap