Conserved Protein Domain Family
PRK13951

?
PRK13951: PRK13951 
bifunctional shikimate kinase AroK/3-dehydroquinate synthase AroB
Statistics
?
PSSM-Id: 172457
View PSSM: PRK13951
Aligned: 6 rows
Threshold Bit Score: 803.738
Threshold Setting Gi: 160902658
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
160902658   1 MKIFLVGMMGSGKTTLAKKISKVLSIPHIDTDDEIEKNENLKIKDIFEKYGEEYFRKLESTILEKLAENTNsFVVSTGGG 80 
170288385   1 MRIFLVGMMGSGKSTIGKRVSEVLDLQFIDMDEEIERREGRSVRRIFEEDGEEYFRLKEKELLRELVERDN-VVVATGGG 79 
15643116    1 MRIFLVGMMGSGKSTIGKRISEVLDLQFIDMDEEIERREGRSVRRIFEEDGEEYFRLKEKELLKELVERDN-VVVATGGG 79 
148269709   1 MRIFLVGMMGSGKSTIGKRVSEVLDLQFIDMDEEIERREGRRVRRIFEEDGEEYFRLKEKELLRELVERDN-VVVATGGG 79 
222099296   1 --------MGSGKSTIGKRVSEVLDLQFIDMDEEIERREGRRVRRIFEEDGEEYFRLKEKELLRELVERDN-VVVATGGG 71 
281412407   1 MRIFLVGMMGSGKSTIGKRVSEVLDLQFIDMDEEIERREGRSVRRIFEEDGEEYFRLKEKELLRELVERDN-VVVATGGG 79 
160902658  81 IILSAKNRAILKKENAIYLKVTPEKLKDRVSLENRPLLANNKENIIKIYKDRKELYEQFKTVDITNLTEWESVAKILYQY 160
170288385  80 VVIDPENRELLKKEKTLFLYAPPEVLMERVTTENRPLLREGKERIREIWERRKQFYTEFRGIDTSKLNEWETTALVVLEA 159
15643116   80 VVVDPENRELLKKEKTLFLYAPPEVLMERVTTENRPLLSEGKERIREIWEKRKQFYAEFRRIDTSRLNEWETTALVVLEA 159
148269709  80 VVIDPENRELLKKEKTLFLYAPPEVLMERVTTENRPLLREGKERIREIWERRKQFYTEFRGIDTSKLNEWETTALVVLEA 159
222099296  72 VVIDPENRELLKKEKTLFLYAPPEVLMERVTTENRPLLREGKERIREIWERRKQFYTEFRGIDTSKLNEWETTALVVLEA 151
281412407  80 VVIDPENRELLKKEKTLFLYAPPEVLMERVTTENRPLLREGKERIREIWEKRKQFYAEFRRIDTSKLNEWETTALVVLEA 159
160902658 161 DIKNHFEIDSSFQKVSINAGSLKSPPPDSIVFTSEKVNELYGEYLPQKKLVLPNGEKTKDISLVIRAYEYLLENNVSRDN 240
170288385 160 LDEKEISTIEKPHLVKIILGGFKRVRNEELVFTTERVEKIYGRYLPENRLLFPDGEEVKTLEHVSRAYYELVRMDFPRGK 239
15643116  160 LDEKEISTIEKPHLVKIILGGFKRVRNEELVFTTERVEKIYGRYLPENRLLFPDGEEVKTLEHVSRAYYELIRMDFPRGK 239
148269709 160 LDEKEISTIEKPHLVKIILGGFKRVRNEELVFTTERVEKIYGRYLPENRLLFPDGEEVKTLEHVSRAYYELVRMDFPRGK 239
222099296 152 LDEKEISTIEKPHLVKIILGGFKRVRNEELVFTTERVEKIYGRYLPENRLLFPDGEEVKTLEHVSRAYYELVRMDFPRGK 231
281412407 160 LDEKEISTIEKPHLVKIILGGFKRVRNEELVFTTERVEKIYGRYLPENRLLFPDGEEVKTLEHVSRAYYELVRMDFPRGK 239
160902658 241 LLLGIGGGTITDFTGFVGSTYKRGMNFSFYPTTLLSQIDAAIGGKNGIDFKKYKNVVGTINLPIEVVIDPLSILSLDDET 320
170288385 240 TIAGVGGGALTDFTGFVASTFKRGVGLSFYPTTLLAQVDASVGGKNAIDFAGVKNVVGTFRMPDYVIIDPTVTLSMDEGR 319
15643116  240 TIAGVGGGALTDFTGFVASTFKRGVGLSFYPTTLLAQVDASVGGKNAIDFAGVKNVVGTFRMPDYVIIDPTVTLSMDEGR 319
148269709 240 TIAGVGGGALTDFTGFVASTFKRGVGLSFYPTTLLAQVDASVGGKNAIDFAGVKNVVGTFRMPDYVIIDPTVTLSMDEGR 319
222099296 232 TIAGVGGGALTDFTGFVASTFKRGVGLSFYPTTLLAQVDASVGGKNAIDFAGVKNIVGTFRMPDYVIIDPVVTLSMDEGR 311
281412407 240 TIAGVGGGALTDFTGFVASTFKRGVGLSFYPTTLLAQVDASVGGKNAIDFAGVKNVVGTFRMPDYVIIDPTVTLSMDEGR 319
160902658 321 FIEGLIEGYKMALISGNDFYEYfkENLQEILNRNLDKLSFFIKRSVEEKLRIVEQDFKDTGLRSCLNLGHTLGHAFEATT 400
170288385 320 FEEGVVEAFKMTILSGRGVELF--DEPEKIEKRNLRVLSEMVKISVEDKARIVMEDPYDMGLRHALNLGHTLGHVYEMLE 397
15643116  320 FEEGVVEAFKMTILSGRGVELF--DEPEKIEKRNLRVLSEMVKISVEEKARIVMEDPYDMGLRHALNLGHTLGHVYEMLE 397
148269709 320 FEEGVVEAFKMTILSGRGVELF--DEPEKIEKRNLRVLSEMVKISVEDKARIVMEDPYDMGLRHALNLGHTLGHVYEMLE 397
222099296 312 FEEGVVEAFKMALLSGRGLELF--DDPEKIERRNLRILSEMVRLSVEEKAKIVMEDPYDKGLRHALNLGHTLGHVYEMLE 389
281412407 320 FEEGVVEAFKMTILSGRGVELF--DEPEKIEKRNLRVLSEMVKISVEDKARIVMEDPYDMGLRHALNLGHTLGHVYEMLE 397
160902658 401 GIAHGLSVGWGLIKEIEFFYKKKYLEEKDYLEIKDTLEALVPEKVRNiqIDEKDIYYYLSNDKKIGANQKIKMPILKSPG 480
170288385 398 GVPHGIAVAWGIEKETMYLYRKGIVPKETMRWIVEKVKQIVPIPVPS--VDVEKARNLILNDKKILKGSRVRLPYVKEIG 475
15643116  398 GVPHGIAVAWGIEKETMYLYRKGIVPKETMRWIVEKVKQIVPIPVPS--VDVEKARNLILNDKKILKGSRVRLPYVKEIG 475
148269709 398 GVPHGIAVAWGIEKETMYLYRKGIVPKETMRWIVEKVKQIVPIPVPS--VDVEKARNLILNDKKILKGSRVRLPYVKEIG 475
222099296 390 GVPHGIAVAWGLEKETMYLYRKGIVPKDTFRWIVEKIKEIVPIPVPA--VDREKARTLILNDKKIMKGSRVRLPYVREPG 467
281412407 398 GVPHGIAVAWGIEKETMYLYRKGIVPKETMRWIVEKVKQIVPIPVPS--VDVEKARNLILNDKKILKGSRVRLPYVKEIG 475
160902658 481 NiiIEEITIKEGEIF 495
170288385 476 K--IEFLEVDPLELL 488
15643116  476 K--IEFLEVDPLELL 488
148269709 476 K--IEFLEVDPLELL 488
222099296 468 K--VEFLEVDPLELL 480
281412407 476 K--IEFLEVDPLELL 488
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap