Conserved Protein Domain Family
PRK13949

?
PRK13949: PRK13949 
shikimate kinase; Provisional
Statistics
?
PSSM-Id: 140006
View PSSM: PRK13949
Aligned: 8 rows
Threshold Bit Score: 285.855
Threshold Setting Gi: 34541244
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
212550556   1 MRRIFLIGYMGAGKTTIGKILAEKLNLSFIDTDFFIKNRYKKEITDIFAGEGEEKFRRIEQKILQEiIQKWENIVISTGG 80 
53711526    1 MIRIFLTGYMGAGKTTLGKALARELHIPFIDLDWYIEERFHKTVGELFSERGEASFRELEKNMLHE-VGEFEDVVISTGG 79 
60679787    1 MIRIFLTGYMGAGKTTLGKALARELHIPFIDLDWYIEERFHKTVGELFSERGEASFRELEKNMLHE-VGEFEDVVISTGG 79 
29348802    1 MVRIFLTGYMGAGKTTLGKAFARKLNVPFIDLDWYIEERFHKTVGELFTERGEAGFRELERNMLHE-VAEFENVVISTGG 79 
34541244    2 HAPIFIVGYMGSGKSTVGRKMADVLGWRFIDTDFFIENRFRKRVADIFRDEGEAVFRRRERVVIEE-LSGMEDAIIATGG 80 
150009401   1 MKRVFLVGYMGAGKTTVGKELAKLAGLSFIDLDYYIEGRYHKAVSQIFAERGEEAFREIERNMLHE-VAEFEDVLISTGG 79 
150003903   1 MTRIFLIGYMGAGKTTLGKAFAREMSLNFIDLDWFIEERFHKTVQQLFLERGEDGFRELERKMLHE-VAEFEDVVVSTGG 79 
188994384   2 HAPIFIVGYMGSGKSTVGRKMADVLGWRFIDTDFFIENRFRKRVADIFRDEGEAVFRRRERVVIEE-LSGMEDAIIATGG 80 
212550556  81 GTPCFFHNMELMNASGTTVYLKATIELLTERLINMKCARPLIKDKSPEEIKYFVINNLVKRELFYNQASIVFFIKKMTMN 160
53711526   80 GAPCFFDNMEYMNRVGTTVFLDVDPKVLFSRLRVAKQQRPILQGKKDDELLDFIVQALEKRAPFYRQANYIYCADKLEDR 159
60679787   80 GAPCFFDNMEYMNRVGTTVFLDVDPKVLFSRLRVAKQQRPILQGKKDDELLDFIVQALEKRAPFYRQANYIYCADKLEDR 159
29348802   80 GAPCFYDNMEFMNRTGKTVFLNVHPDVLFRRLRIAKQQRPILQGKEDDELMDFIIQALEKRAPFYTQAQYIFNADELEDR 159
34541244   81 GLPCHSDNMTLMNEAGLTLYLEVSDEVLAVRLELCKRTRPKVKDKTGEELLSHIREEMAFRGDIYRRAKVIVNSDKLVDE 160
150009401  80 GAPCFFDNMEFMNASGTTVYLKVSVEELAKRLELCKHTRPVLKGRSGEELRAFIAESLEKRNPFYTKASITFDAEKMLTE 159
150003903  80 GTPCFFDNMEYMNDCGDTVFLDVEPAVLFRRLRVAKQQRPLLANKSDEELMDFICEALQKRHPFYSKAKHLFKADELEDK 159
188994384  81 GLPCHSDNMTLMNEAGLTLYLEVSDEVLAVRLELCKRTRPKVKDKTGEELLSHIREEMAFRGDIYRRAKVIVNSDKLVDE 160
212550556 161 DIIENLMPKI 170
53711526  160 SQIETSVQQL 169
60679787  160 SQIETSVQQL 169
29348802  160 WQIESSVQRL 169
34541244  161 EDERQLVTRI 170
150009401 160 SDVHDISNAL 169
150003903 160 RQIQASVDSL 169
188994384 161 EDERQLVTRI 170
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap