Conserved Protein Domain Family
PRK13944

?
PRK13944: PRK13944 
protein-L-isoaspartate O-methyltransferase; Provisional
Statistics
?
PSSM-Id: 140001
View PSSM: PRK13944
Aligned: 6 rows
Threshold Bit Score: 338.326
Threshold Setting Gi: 159042097
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
171186428   1 MAHRLVEELVREGVIKSESVRRAMLAVPREEFVMPEYRMMAYEDRPLPLFADATISAPHMVAMMCELVEPKPGMKILEVG 80 
159042097   9 ARRRLVDDLKADGIIVSREVEEAMLSVPRHLFVPNYIRHYAYQDTPLTIMRGQTISAPHMVAIMCELIKPRRGMRILEVG 88 
18312114    1 MAKRLVEELERDGIVKSERVKRALLTVPREEFVLPEYRMMAYEDRPLPLFAGATISAPHMVAMMCELIEPRPGMKILEVG 80 
126460721   1 MAARLVAELVKEGVIKSERVKNAMLKVPREEFVTPEYRMMAYEDRPLPLFAGATISAPHMVAMMCELIEPRPGMKILEVG 80 
145592542   1 MAKKLVDDLEREGVLKSERVKKALLSVPREEFVMPEYRMMAYEDRPLPLFADATISAPHMVAMMCELIEPRPGMSILEVG 80 
119872194   1 MALRLVEELTNEGIIKTERVKKAMLAVPREEFVMPEYRMMAYEDRPLPLFFDATISAPHMVAMMCELVEPRPGMKILEVG 80 
171186428  81 AGSGYQAAVCAEAMErRGRVYTVEIVKELAIYAAQNIERLGYWGVVEVYHGDGRSGLERHAPFDAIIVTAAARQIPPALV 160
159042097  89 AGTGYQACVCARAIG-DGVVYSVEIDPYIALYATVNIIHAGFSGMVKVYQGDGKLGLPKHAPFDAVLVTAAASTVPQPLL 167
18312114   81 TGSGYHAAVCAEAIEkKGRIYTIEIVKELAVFAAQNLERLGYWGVVEVYHGDGKKGLEKHAPFDAIIVTAAADVIPPALI 160
126460721  81 TGSGYHAAVCAEAIErQGKVYTVEIVRELAIFAAQNLERLGYLGVVEVYRGDGRRGLERHAPFDAVLVTAAASEIPKALV 160
145592542  81 TGSGYHAAVCAEAIErRGKVYTVEIVKGLAIYAAQNLERLGYWGVVEVFHSDGKRGLEKFAPYDAIIVTAAAASIPSALV 160
119872194  81 TGSGYQAAVCAEAIErKGKVYTIEIVKELAIYAAQNIERLGYWGIVEVYHGDGKKGLERHAPFDAIIVTAAARTIPSELI 160
171186428 161 RQLKEGGTLVIPLVEHMGQILYKVTKRGERVEKRAVTYVLFVPLR 205
159042097 168 DQLTMGGVLVIPLKEDGYQKLYVIEKGKEGFRKRFITYVSFVDLR 212
18312114  161 RQLKDGGVMVIPVEERLGQVLYKVVKRGDKIEKKAITYVMFVPLR 205
126460721 161 EQLREGGVMVIPVEEGVGQVLYKVVKSGGKVKRQAVTYVLFVPLR 205
145592542 161 NQLKDGGIMVIPVEEGFGQVLYKVVRRGEKTEKKAVTYVLFVPLR 205
119872194 161 KQLKDGGVLVIPIEEGVGQVLYKITKRGEKIEKRAITYVLFVPLR 205
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap