Conserved Protein Domain Family
PRK13940

?
PRK13940: PRK13940 
glutamyl-tRNA reductase; Provisional
Statistics
?
PSSM-Id: 172450
View PSSM: PRK13940
Aligned: 9 rows
Threshold Bit Score: 744.143
Threshold Setting Gi: 169656742
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
118498114   1 MALISLAIDYKKSPIEVRSEFALSGLDVSMLYRSILAIDNVVHAVILSTCNRTEVYLEISDLRVVDDILVWWQGYVRNPN 80 
134301374   1 MALISLAIDYKKSPIEVRSEFALSGLDVSMLYRSILAIDNVVHAVILSTCNRTEVYLEISDLRVVDDILVWWQGYVRNPN 80 
89256991    1 MALISLAIDYKKSPIEVRSEFALSGLDVSMLYRSILAIDNVVHAVILSTCNRTEVYLEISDLRVVDDILVWWQGYVRNPN 80 
110669807   3 MALISLAIDYKKSPIEVRSEFALSGLDVSMLYRSILAIDNVVHAVILSTCNRTEVYLEISDLRVVDDILVWWQGYVRNPN 82 
115315351   3 MALISLAIDYKKSPIEVRSEFALSGLDVSMLYRSILAIDNVVHAVILSTCNRTEVYLEISNLRVVDDILVWWQGYVRNPN 82 
56707337    3 MALISLAIDYKKSPIEVRSEFALSGLDVSMLYRSILAIDNVVHAVILSTCNRTEVYLEISDLRVVDDILVWWQGYVRNPN 82 
169656742   3 MALISLAIDYKKSPIEVRSEFALSGLDVSMLYRSILAIDNVVHAVILSTCNRTEVYLEISDLIVVDDILVWWQGYVRNPN 82 
167627295   1 MALISLAIDYKKSPIEVRSEFALSGLDVSMLYKSILAIDNVVHAVILSTCNRTEVYLEITDLRVVDDILAWWQSYVRNPE 80 
187931102   1 MALISLAIDYKKSPIEVRSEFALSGLDVSMLYRSILAIDNVVHAVILSTCNRTEVYLEISDLRVVDDILVWWQGYVRNPN 80 
118498114  81 YKIKDYFKLRQGTEVIMHLMKLACGLESMVLGEPQILGQVKDSYTLSKKNHAIGKELDRVFQKVFATAKRVRSETRIGYC 160
134301374  81 YKIKDYFKLRQGTEVIMHLMKLACGLESMVLGEPQILGQVKDSYTLSKKNHAIGKELDRVFQKVFATAKRVRSETRIGHC 160
89256991   81 YKIKDYFKLRQGTEVIMHLMKLACGLESMVLGEPQILGQVKDSYTLSKKNHAIGKELDRVFQKVFATAKRVRSETRIGYC 160
110669807  83 YKIKDYFKLRQGTEVIMHLMKLACGLESMVLGEPQILGQVKDSYTLSKKNHAIGKELDRVFQKVFATAKRVRSETRIGHC 162
115315351  83 YKIKDYFKLRQGTEVIMHLMKLACGLESMVLGEPQILGQVKDSYTLSKKNHAIGKELDRVFQKVFATAKRVRSETRIGYC 162
56707337   83 YKIKDYFKLRQGTEVIMHLMKLACGLESMVLGEPQILGQVKDSYTLSKKNHAIGKELDRVFQKVFATAKRVRSETRIGHC 162
169656742  83 YKIKDYFKLRQGTEVIMHLMKLACGLESMVLGEPQILGQVKDSYTLSKKNHAIGKELDRVFQKVFATAKRVRSETRIGYC 162
167627295  81 FKIRDYFKLRQGTEVIMHLMKLACGLESMVLGEPQILGQVKDSYTLSKKNHAIGKELDRVFQKVFATAKKVRSETRIGHC 160
187931102  81 YKIKDYFKLRQGTEVIMHLMKLACGLESMVLGEPQILGQVKDSYTLSKKNHAIGKELDRVFQKVFATAKRVRSETRIGHC 160
118498114 161 PVSVAFSAITLAKRQLDNICSKNVLIIGAGQTGELLFRHVTALAPKQIMLANRTIEKAQKITSAFRNASAHYLSELPQLI 240
134301374 161 PVSVAFSAITLAKRQLDNISSKNVLIIGAGQTGELLFRHVTALAPKQIMLANRTIEKAQKITSAFRNASAHYLSELPQLI 240
89256991  161 PVSVAFSAITLAKRQLDNISSKNVLIIGAGQTGELLFRHVTALAPKQIMLANRTIEKAQKITSVFRNASAHYLSELPQLI 240
110669807 163 PVSVAFSAITLAKRQLDNISSKNVLIIGAGQTGELLFRHVTALAPKQIMLANRTIEKAQKITSAFRNASAHYLSELPQLI 242
115315351 163 PVSVAFSAITLAKRQLDNISSKNVLIIGAGQTGELLFRHVTALAPKQIMLANRTIEKAQKITSVFRNASAHYLSELPQLI 242
56707337  163 PVSVAFSAITLAKRQLDNISSKNVLIIGAGQTGELLFRHVTALAPKQIMLANRTIEKAQKITSAFRNASAHYLSELPQLI 242
169656742 163 PVSVAFSAITLAKRQLDNISSKNVLIIGAGQTGELLFRHVTALAPKQIMLANRTIEKAQKITSVFRNASAHYLSELPQLI 242
167627295 161 PVSVAFSAITLAKKQLDNISTKNVLIIGAGQTGELLFRHVTALNPKHIMLANRTIEKAEKITSTFNNASAYYLSDLPKLI 240
187931102 161 PVSVAFSAITLAKRQLDNISSKNVLIIGAGQTGELLFRHVTALAPKQIMLANRTIEKAQKITSAFRNASAHYLSELPQLI 240
118498114 241 KKADIIIAAVNVSEYIVTCKDVGDKPRVFIDISIPQALDPKLGELEQNVYYCVDDINAVIEDNKDKRKYESSKAQKIIVK 320
134301374 241 KKADIIIAAVNVLEYIVTCKYVGDKPRVFIDISIPQALDPKLGELEQNVYYCVDDINAVIEDNKDKRKYESSKAQKIIVK 320
89256991  241 KKADIIIAAVNVLEYIVTCKYVGDKPRVFIDISIPQALDPKLGELEQNVYYCVDDINAVIEDNKDKRKYESSKAQKIIVK 320
110669807 243 KKADIIIAAVNVLEYIVTCKYVGDKPRVFIDISIPQALDPKLGELEQNVYYCVDDINAVIEDNKDKRKYESSKAQKIIVK 322
115315351 243 KKADIIIAAVNVLEYIVTCKYVGDKPRVFIDISIPQALDPKLGELEQNVYYCVDDINAVIEDNKDKRKYESSKAQKIIVK 322
56707337  243 KKADIIIAAVNVLEYIVTCKYVGDKPRVFIDISIPQALDPKLGELEQNVYYCVDDINAVIEDNKDKRKYESSKAQKIIVK 322
169656742 243 KKADIIIAAVNVLEYIVTCKYVGDKPRVFIDISIPQALDPKLGELEQNVYYCVDDINAVIEDNKDKRKYESSKAQKIIVK 322
167627295 241 KKADIIIAAVNVTEYIVKCEDVGEKSRVFIDISIPQALDPKLGDLEQNAYYCVDDINTVIEGNKDKRKHESSRAQKIIVK 320
187931102 241 KKADIIIAAVNVLEYIVTCKYVGDKPRVFIDISIPQALDPKLGELEQNVYYCVDDINAVIEDNKDKRKYESSKAQKIIVK 320
118498114 321 SLEEYLEKEKAIISNSAIKELFQKADGLVDLSLEKSLAKIRNGKDAEEIIKRFAYEIKKKVLHYPVVGMKEASKQGRSDC 400
134301374 321 SLEEYLEKEKAIISNSAIKELFQKADGLVDLSLEKSLAKIRNGKDAEEIIKRFAYEIKKKVLHYPVVGMKEASKQGRSDC 400
89256991  321 SLEEYLEKEKAIISNSAIKELFQKADGLVDLSLEKSLAKIRNGKDAEEIIKRFAYEIKKKVLHYPVVGMKEASKQGRSDC 400
110669807 323 SLEEYLEKEKAIISNSAIKELFQKADGLVDLSLEKSLAKIRNGKDAEEIIKRFAYEIKKKVLHYPVVGMKEASKQGRSDC 402
115315351 323 SLEEYLEKEKAIISNSAIKELFQKADGLVDLSLEKSLAKIRNGKDAEEIIKRFAYEIKKKVLHYPVVGMKEASKQGRSDC 402
56707337  323 SLEEYLEKEKAIISNSAIKELFQKADGLVDLSLEKSLAKIRNGKDAEEIIKRFAYEIKKKVLHYPVVGMKEASKQGRSDC 402
169656742 323 SLEEYLEKEKAIISNSAIKELFQKADGLVDLSLEKSLAKIRNGKDAEEIIKRFAYEIKKKVLHYPVVGMKEASKQGRSDC 402
167627295 321 SLEDYLEKEKAIISNSAIKELFQKADGLVDLSLEKSLAKIRNGKDPEEVLKRFAYEIKKKVLHYPVVGMKEASKQGRSDC 400
187931102 321 SLEEYLEKEKAIISNSAIKELFQKADGLVDLSLEKSLAKIRNGKDAEEIIKRFAYEIKKKVLHYPVVGMKEASKQGRSDC 400
118498114 401 LVCMKRMFGLNVEK 414
134301374 401 LVCMKRMFGLNVEK 414
89256991  401 LVCMKRMFGLNVEK 414
110669807 403 LVCMKRMFGLNVEK 416
115315351 403 LVCMKRMFGLNVEK 416
56707337  403 LVCMKRMFGLNVEK 416
169656742 403 LVCMKRMFGLNVEK 416
167627295 401 LVCMKRMFGLNVEK 414
187931102 401 LVCMKRMFGLNVEK 414
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap